Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human TGFA/TGF-alpha (Iv0068)

Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €439.00.Current price is: €366.00.

100ug 17% OFF + 366 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human TGFA/TGF-alpha (Iv0068)

Product name ARO-A13306-100
Uniprot ID P01135
Raw Antigen Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TGFA, ETGF, Protransforming growth factor alpha, TGF type 1, EGF-like TGF, TGF-alpha
Reference ARO-A13306
Clonality Monoclonal Antibody
Protein Name TGFA
Product name ARO-A13306-1MG
Uniprot ID P01135
Raw Antigen Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TGFA, ETGF, Protransforming growth factor alpha, TGF type 1, EGF-like TGF, TGF-alpha
Reference ARO-A13306
Clonality Monoclonal Antibody
Protein Name TGFA
Product name ARO-A13306-50
Uniprot ID P01135
Raw Antigen Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-TGFA, ETGF, Protransforming growth factor alpha, TGF type 1, EGF-like TGF, TGF-alpha
Reference ARO-A13306
Clonality Monoclonal Antibody
Protein Name TGFA

SDS-PAGE for InVivoMAb Anti-Human TGFA/TGF-alpha (Iv0068)

SDS-PAGE for InVivoMAb Anti-Human TGFA/TGF-alpha (Iv0068)

InVivoMAb Anti-Human TGFA/TGF-alpha (Iv0068), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human TGFA/TGF-alpha (Iv0068)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products