Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse Interleukin-18(Il18)

Host species:
Mammalian cells
Origin species:
House Mouse
Uniprot ID:
P70380
Molecular weight:
46.12kDa

Original price was: €263.00.Current price is: €210.00.

50ug 20% OFF + 210 loyalty points
Met1–Ser192 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse Interleukin-18(Il18)

Product name Mouse Interleukin-18(Il18)
Uniprot ID P70380
Uniprot link https://www.uniprot.org/uniprot/P70380
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Molecular weight 46.12kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser192
Protein Accession P70380
Spec:Entrez GeneID 16173
Spec:NCBI Gene Aliases Ig; Il-; Igif; Il-18
NCBI Reference P70380
Aliases /Synonyms IL-18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif
Reference PX-P4661
Note For research use only
Molecular Constructor
Met1–Ser192 Fc
Product name Mouse Interleukin-18(Il18)
Uniprot ID P70380
Uniprot link https://www.uniprot.org/uniprot/P70380
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Molecular weight 46.12kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser192
Protein Accession P70380
Spec:Entrez GeneID 16173
Spec:NCBI Gene Aliases Ig; Il-; Igif; Il-18
NCBI Reference P70380
Aliases /Synonyms IL-18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif
Reference PX-P4661
Note For research use only
Molecular Constructor
Met1–Ser192 Fc
Product name PX-P4661-1MG
Uniprot ID P70380
Uniprot link https://www.uniprot.org/uniprot/P70380
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Molecular weight 46.12kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser192
Protein Accession P70380
Spec:Entrez GeneID 16173
Spec:NCBI Gene Aliases Ig; Il-; Igif; Il-18
NCBI Reference P70380
Aliases /Synonyms IL-18,Interferon gamma-inducing factor,IFN-gamma-inducing factor,Interleukin-1 gamma,IL-1 gamma,Igif
Reference PX-P4661
Note For research use only
Molecular Constructor
Met1–Ser192 Fc

Mouse Interleukin-18(Il18)

There are no reviews yet.

Be the first to review “Mouse Interleukin-18(Il18)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products