Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse Interleukin-12 subunit beta(Il12b)

Host species:
Mammalian cells
Origin species:
House Mouse
Uniprot ID:
P43432
Molecular weight:
42-50kDa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Met1–Ser335 Twin-Strep
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse Interleukin-12 subunit beta(Il12b)

Product name Mouse Interleukin-12 subunit beta(Il12b)
Uniprot ID P43432
Uniprot link https://www.uniprot.org/uniprot/P43432
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight 42-50kDa
Protein delivered with Tag? C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser335
Protein Accession P43432
Spec:Entrez GeneID 16160
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40
Spec:SwissProtID Q9QUM1
NCBI Reference P43432
Aliases /Synonyms Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;IL-12 subunit p40
Reference PX-P4571
Note For research use only
Molecular Constructor
Met1–Ser335 Twin-Strep
Product name Mouse Interleukin-12 subunit beta(Il12b)
Uniprot ID P43432
Uniprot link https://www.uniprot.org/uniprot/P43432
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight 42-50kDa
Protein delivered with Tag? C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser335
Protein Accession P43432
Spec:Entrez GeneID 16160
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40
Spec:SwissProtID Q9QUM1
NCBI Reference P43432
Aliases /Synonyms Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;IL-12 subunit p40
Reference PX-P4571
Note For research use only
Molecular Constructor
Met1–Ser335 Twin-Strep
Product name PX-P4571-1MG
Uniprot ID P43432
Uniprot link https://www.uniprot.org/uniprot/P43432
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular weight 42-50kDa
Protein delivered with Tag? C-terminal Twin-Strep tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser335
Protein Accession P43432
Spec:Entrez GeneID 16160
Spec:NCBI Gene Aliases p40; Il-1; Il-12; Il-12b; Il12p40; Il-12p40
Spec:SwissProtID Q9QUM1
NCBI Reference P43432
Aliases /Synonyms Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;IL-12 subunit p40
Reference PX-P4571
Note For research use only
Molecular Constructor
Met1–Ser335 Twin-Strep

Mouse Interleukin-12 subunit beta(Il12b)

There are no reviews yet.

Be the first to review “Mouse Interleukin-12 subunit beta(Il12b)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products