Brand: ProteoGenix

Interferon-induced transmembrane protein 1(IFITM1)

PX-P4692-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P13164

€210.00

50ug + 210 loyalty points

Met1–Phe57 sumo

size size

50ug €210.00
100ug €420.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Interferon-induced transmembrane protein 1(IFITM1)

Product name	Interferon-induced transmembrane protein 1(IFITM1)
Uniprot ID	P13164
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAF
Protein delivered with Tag?	C-terminal sumo tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Phe57
Aliases /Synonyms	Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17
Reference	PX-P4692
Note	For research use only
Molecular Constructor	Met1–Phe57 sumo

Product name	Interferon-induced transmembrane protein 1(IFITM1)
Uniprot ID	P13164
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAF
Protein delivered with Tag?	C-terminal sumo tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Phe57
Aliases /Synonyms	Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17
Reference	PX-P4692
Note	For research use only
Molecular Constructor	Met1–Phe57 sumo