Name: Interferon-induced transmembrane protein 1(IFITM1)
SKU: PX-P4692-10
Availability: InStock

Product name	Interferon-induced transmembrane protein 1(IFITM1)
Uniprot ID	P13164
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Protein delivered with Tag?	C-terminal sumo tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1-Phe57
Aliases /Synonyms	Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17
Reference	PX-P4692
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Interferon-induced transmembrane protein 1(IFITM1)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Interferon-induced transmembrane protein 1(IFITM1)