Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Interferon-induced transmembrane protein 1(IFITM1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P13164

€210.00

50ug + 210 loyalty points
Met1–Phe57 sumo
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Interferon-induced transmembrane protein 1(IFITM1)

Interferon-induced transmembrane protein 1(IFITM1)

Product name Interferon-induced transmembrane protein 1(IFITM1)
Uniprot ID P13164
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Protein delivered with Tag? C-terminal sumo tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Phe57
Aliases /Synonyms Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17
Reference PX-P4692
Note For research use only
Molecular Constructor
Met1–Phe57 sumo
Product name Interferon-induced transmembrane protein 1(IFITM1)
Uniprot ID P13164
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Protein delivered with Tag? C-terminal sumo tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Phe57
Aliases /Synonyms Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17
Reference PX-P4692
Note For research use only
Molecular Constructor
Met1–Phe57 sumo

There are no reviews yet.

Be the first to review “Interferon-induced transmembrane protein 1(IFITM1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products