Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iluzanebart Biosimilar – Anti-Triggering receptor expressed on myeloid cells 2 mAb – Research Grade

  • PX-TA1952-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €240.00.Current price is: €200.00.

100ug 17% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade

Product name Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade
Uniprot ID Q9NZC2
Source CAS: 2733621-19-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference PX-TA1952
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade
Uniprot ID Q9NZC2
Source CAS: 2733621-19-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference PX-TA1952
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1952-50
Uniprot ID Q9NZC2
Source CAS: 2733621-19-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference PX-TA1952
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Iluzanebart Biosimilar is a promising therapeutic antibody that targets the Triggering receptor expressed on myeloid cells 2 (TREM2) protein. This biosimilar is a research-grade version of the original Iluzanebart antibody, which has shown significant potential in treating various neurological disorders. In this article, we will delve into the structure, activity, and potential applications of Iluzanebart Biosimilar in the field of immunotherapy.

Structure of Iluzanebart Biosimilar

Iluzanebart Biosimilar is a monoclonal antibody, which means it is produced from a single type of immune cell. It is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. The heavy chains contain a variable region, responsible for binding to the target protein, and a constant region, which determines the antibody’s effector functions. The light chains also have a variable and a constant region, but their main role is to assist in target binding. Iluzanebart Biosimilar has a molecular weight of approximately 150 kDa and is highly specific to TREM2 protein.

Activity of Iluzanebart Biosimilar

TREM2 is a transmembrane protein that is expressed on the surface of myeloid cells, such as macrophages and microglia. It plays a crucial role in modulating the immune response and maintaining tissue homeostasis. However, in certain neurological disorders, such as Alzheimer’s disease and multiple sclerosis, TREM2 is overactivated, leading to an excessive inflammatory response and tissue damage. Iluzanebart Biosimilar works by binding to TREM2 and inhibiting its activity, thereby reducing inflammation and protecting against tissue damage.

Applications of Iluzanebart Biosimilar

Due to its specific targeting of TREM2, Iluzanebart Biosimilar has potential applications in various neurological disorders. In Alzheimer’s disease, for example, the overactivation of TREM2 leads to the accumulation of amyloid plaques and neuroinflammation, which are key contributors to disease progression. By inhibiting TREM2, Iluzanebart Biosimilar can potentially slow down the progression of the disease and improve cognitive function. Similarly, in multiple sclerosis, the overactivation of TREM2 leads to demyelination of nerve fibers, causing neurological symptoms. Iluzanebart Biosimilar can potentially prevent this demyelination and improve the overall outcome of the disease.

Aside from neurological disorders, Iluzanebart Biosimilar may also have applications in other inflammatory conditions, such as rheumatoid arthritis and inflammatory bowel disease. In these diseases, TREM2 is also overactivated, leading to tissue damage and inflammation. By targeting TREM2, Iluzanebart Biosimilar can potentially reduce inflammation and improve disease outcomes.

Future Directions

Iluzanebart Biosimilar is currently in the early stages of research and development, with promising preclinical data. However, more studies are needed to fully understand its potential and determine its safety and efficacy in human trials. Additionally, further research is needed to explore the potential of Iluzanebart Biosimilar in other inflammatory conditions and to optimize its dosing and administration.

Conclusion

In summary, Iluzanebart Biosimilar is a research-grade antibody that targets the TREM2 protein. Its specific binding to TREM2 makes it a promising candidate for the treatment of various neurological and inflammatory disorders. With further research and development, Iluzanebart Biosimilar has the potential to become a valuable addition to the arsenal of immunotherapies targeting TREM2.

SDS-PAGE for Research Grade Iluzanebart

SDS-PAGE for Research Grade Iluzanebart

Research Grade Iluzanebart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Iluzanebart in ELISA Assay

Research Grade Iluzanebart in ELISA Assay

Research Grade Iluzanebart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Iluzanebart Biosimilar - Anti-Triggering receptor expressed on myeloid cells 2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Iluzanebart Biosimilar – Anti-Triggering receptor expressed on myeloid cells 2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products