Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV)

  • PTX26654-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1 (ATV)

Original price was: €366.00.Current price is: €265.00.

50ug 28% OFF + 265 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV)

Product name PTX26654-100
Uniprot ID Q9NZC2
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-TERM2
Isotype IgG1 (ATV)
Clonality Monoclonal Antibody
Protein Name TERM2
Product name PTX26654-1MG
Uniprot ID Q9NZC2
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-TERM2
Isotype IgG1 (ATV)
Clonality Monoclonal Antibody
Protein Name TERM2
Product name PTX26654-50
Uniprot ID Q9NZC2
Raw Antigen Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-TERM2
Isotype IgG1 (ATV)
Clonality Monoclonal Antibody
Protein Name TERM2

Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV) binds to Human TREM2 recombinant protein in WB Assay

Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV) binds to Human TREM2 recombinant protein in WB Assay

Human TREM2 recombinant protein(cat. No.PX-P6295) can bind Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV)

SDS-PAGE for Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV)

Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human TERM2 Monoclonal Antibody (DNL919-ATV)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products