Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iladatuzumab Biosimilar – Anti-CD79B mAb – Research Grade

  • PX-TA1488-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

Product name Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade
Uniprot ID P40259
Source CAS 1906205-76-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Iladatuzumab,MCDS0593A,RO7032005,CD79B,anti-CD79B
Reference PX-TA1488
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade
Uniprot ID P40259
Source CAS 1906205-76-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Iladatuzumab,MCDS0593A,RO7032005,CD79B,anti-CD79B
Reference PX-TA1488
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1488-50
Uniprot ID P40259
Source CAS 1906205-76-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Iladatuzumab,MCDS0593A,RO7032005,CD79B,anti-CD79B
Reference PX-TA1488
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Iladatuzumab Biosimilar, also known as Anti-CD79B mAb, is a monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody, obinutuzumab. It specifically targets CD79B, a protein that is expressed on the surface of B-cells. This article will provide a scientific description of Iladatuzumab Biosimilar, including its structure, activity, and potential applications.

Structure of Iladatuzumab Biosimilar

Iladatuzumab Biosimilar is a recombinant monoclonal antibody that has been engineered to have a similar structure to obinutuzumab. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL1) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the target protein, CD79B.

Activity of Iladatuzumab Biosimilar

Iladatuzumab Biosimilar binds to CD79B with high specificity and affinity, leading to the inhibition of B-cell receptor (BCR) signaling. CD79B is a key component of the BCR complex, which is responsible for initiating B-cell activation and proliferation. By targeting CD79B, Iladatuzumab Biosimilar effectively blocks BCR signaling, preventing B-cell activation and proliferation.

In addition to its direct activity on B-cells, Iladatuzumab Biosimilar also has an indirect mechanism of action. It has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against CD79B-expressing B-cells. This means that Iladatuzumab Biosimilar can recruit immune cells and complement proteins to target and kill B-cells, further enhancing its therapeutic activity.

Potential Applications of Iladatuzumab Biosimilar

Iladatuzumab Biosimilar has been developed as a potential treatment for B-cell malignancies, including non-Hodgkin’s lymphoma (NHL) and chronic lymphocytic leukemia (CLL). CD79B is highly expressed on the surface of B-cell lymphomas and leukemias, making it an ideal therapeutic target for Iladatuzumab Biosimilar. In preclinical studies, Iladatuzumab Biosimilar has shown promising results in inhibiting tumor growth and inducing cell death in CD79B-positive cancer cells.

Furthermore, Iladatuzumab Biosimilar has the potential to be used in combination with other therapies, such as chemotherapy or other targeted therapies. The combination of Iladatuzumab Biosimilar with other treatments may lead to synergistic effects and improve overall treatment outcomes.

Iladatuzumab Biosimilar is also being investigated for its potential use in autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. CD79B has been implicated in the pathogenesis of these diseases, and targeting it with Iladatuzumab Biosimilar may provide a novel therapeutic approach.

Conclusion

In summary, Iladatuzumab Biosimilar is a recombinant monoclonal antibody that specifically targets CD79B, a protein expressed on the surface of B-cells. Its structure is similar to that of obinutuzumab, and it has been shown to have high specificity and affinity for CD79B. Iladatuzumab Biosimilar inhibits BCR signaling and has the potential to induce ADCC and CDC against CD79B-expressing cells. It is being developed as a potential treatment for B-cell malignancies and autoimmune diseases. Further research is needed to fully understand the therapeutic potential of Iladatuzumab Biosimilar and its role in the treatment of these diseases.

Flow Cytometry results for Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

Flow Cytometry results for Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade in WB Assay

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade in WB Assay

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Iladatuzumab Biosimilar - Anti-CD79B mAb - Research Grade

There are no reviews yet.

Be the first to review “Iladatuzumab Biosimilar – Anti-CD79B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products