Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IL1B / IL1F2, C-His, recombinant protein

  • PX-P5783
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01584
Molecular weight:
18.3 kDa

329.00

100ug + 329 loyalty points
Ala117–Ser269 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

IL1B / IL1F2, C-His, recombinant protein

Product name IL1B / IL1F2, C-His, recombinant protein
Uniprot ID P01584
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 18.3 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala117-Ser269
Protein Accession P01584
Reference PX-P5783
Note For research use only
Molecular Constructor
Ala117–Ser269 His

IL1B / IL1F2, C-His, recombinant protein binds to Canakinumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

IL1B / IL1F2, C-His, recombinant protein binds to Canakinumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

Immobilized IL1B / IL1F2, C-His, recombinant protein (cat. No.PX-P5783) at 0.5µg/mL (100µL/well) can bind Canakinumab Biosimilar - Anti-IL1B mAb (cat. No.PX-TA1176) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1182M.

IL1B / IL1F2, C-His, recombinant protein binds to Gevokizumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

IL1B / IL1F2, C-His, recombinant protein binds to Gevokizumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

Immobilized IL1B / IL1F2, C-His, recombinant protein (cat. No.PX-P5783) at 0.5µg/mL (100µL/well) can bind Gevokizumab Biosimilar - Anti-IL1B mAb (cat. No.PX-TA1068) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 4.405M.

IL1B / IL1F2, C-His, recombinant protein

There are no reviews yet.

Be the first to review “IL1B / IL1F2, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products