Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gevokizumab Biosimilar – Anti-IL1B mAb – Research Grade

  • PX-TA1068-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

Product name Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 1129435-60-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gevokizumab,XOMA 052,IL1B,anti-IL1B
Reference PX-TA1068
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 1129435-60-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gevokizumab,XOMA 052,IL1B,anti-IL1B
Reference PX-TA1068
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1068-50
Uniprot ID P01584
Source CAS 1129435-60-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gevokizumab,XOMA 052,IL1B,anti-IL1B
Reference PX-TA1068
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Gevokizumab Biosimilar, also known as Anti-IL1B mAb, is a research grade monoclonal antibody that targets the cytokine interleukin-1 beta (IL-1B). This antibody has shown promising results in clinical trials for the treatment of inflammatory diseases and is currently being developed as a biosimilar to the original drug, gevokizumab.

Structure of Gevokizumab Biosimilar

Gevokizumab Biosimilar is a humanized monoclonal antibody, meaning it is derived from both human and mouse sources. It consists of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. These chains are linked by disulfide bonds and form a Y-shaped structure.

The variable regions of the antibody, located at the tips of the Y, are responsible for binding to IL-1B. The constant regions, located at the base of the Y, are responsible for mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

IL-1B is a pro-inflammatory cytokine that plays a key role in the pathogenesis of many diseases, including rheumatoid arthritis, gout, and type 2 diabetes. Gevokizumab Biosimilar works by binding to IL-1B and preventing it from interacting with its receptors on target cells.

By blocking the activity of IL-1B, Gevokizumab Biosimilar reduces inflammation and associated symptoms such as pain and swelling. It also helps to regulate the immune response and promote tissue repair.

Applications of Gevokizumab Biosimilar

Gevokizumab Biosimilar has shown promising results in clinical trials for the treatment of various inflammatory diseases. It has been studied in patients with rheumatoid arthritis, psoriasis, and gout, among others.

One of the key advantages of this biosimilar is its potential to offer a more cost-effective alternative to the original drug, gevokizumab. This could make it more accessible to patients in need of treatment for these debilitating diseases.

Research Grade vs. Therapeutic Grade

Gevokizumab Biosimilar is currently being developed as a research grade antibody, meaning it is intended for use in laboratory research and not for human therapeutic purposes. However, it is important to note that the same antibody can be used for both research and therapeutic purposes, as long as it meets the necessary quality and safety standards.

In order for Gevokizumab Biosimilar to be approved for therapeutic use, it will need to undergo further clinical trials and meet stringent regulatory requirements. This process can take several years, but if successful, the biosimilar could potentially provide a more affordable treatment option for patients.

Conclusion

Gevokizumab Biosimilar, also known as Anti-IL1B mAb, is a research grade monoclonal antibody that targets the pro-inflammatory cytokine IL-1B. It has shown promising results in clinical trials for the treatment of inflammatory diseases and is being developed as a biosimilar to the original drug, gevokizumab. Its unique structure and mechanism of action make it a promising candidate for the treatment of various inflammatory conditions. Further research and development will be necessary before it can be approved for therapeutic use, but if successful, it could offer a more cost-effective treatment option for patients in need.

IL1B / IL1F2, C-His, recombinant protein binds to Gevokizumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

IL1B / IL1F2, C-His, recombinant protein binds to Gevokizumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

Immobilized IL1B / IL1F2, C-His, recombinant protein (cat. No.PX-P5783) at 0.5µg/mL (100µL/well) can bind Gevokizumab Biosimilar - Anti-IL1B mAb (cat. No.PX-TA1068) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 4.405M.

SDS-PAGE for Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

SDS-PAGE for Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

There are no reviews yet.

Be the first to review “Gevokizumab Biosimilar – Anti-IL1B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products