Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human NKG2D-CD314 recombinant protein, C-His Tag

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P26718
Molecular weight:
15.29kDa

210.00

50ug + 210 loyalty points
Phe78–Val216 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human NKG2D-CD314 recombinant protein, C-His Tag

Product name Human NKG2D-CD314 recombinant protein, C-His Tag
Uniprot ID P26718
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Molecular weight 15.29kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe78-Val216
Aliases /Synonyms KLRK1 D12S2489E, NKG2D
Reference PX-P4902
Note For research use only
Molecular Constructor
Phe78–Val216 His
Product name Human NKG2D-CD314 recombinant protein, C-His Tag
Uniprot ID P26718
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Molecular weight 15.29kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe78-Val216
Aliases /Synonyms KLRK1 D12S2489E, NKG2D
Reference PX-P4902
Note For research use only
Molecular Constructor
Phe78–Val216 His

SDS-PAGE for Human NKG2D-CD314 recombinant protein, C-His Tag

SDS-PAGE for Human NKG2D-CD314 recombinant protein, C-His Tag

Human NKG2D-CD314 recombinant protein, C-His Tag, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human NKG2D-CD314 recombinant protein, C-His Tag

There are no reviews yet.

Be the first to review “Human NKG2D-CD314 recombinant protein, C-His Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products