Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Interleukin-1 beta recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human Interleukin-1 beta recombinant protein |
|---|---|
| Uniprot ID | P01584 |
| Uniprot link | http://www.uniprot.org/uniprot/P01584 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSHHHHHH |
| Molecular weight | 18.3kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Aliases /Synonyms | IL1-B, IL1-Beta, IL1F2, IL-1β, Interleukin-1 Family Member 2, Catabolin |
| Reference | PX-P4022 |
| Note | For research use only |
Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay
Related products
Biosimilar
Biciromab Biosimilar – Anti-Fibrin II beta chain,fibrin mAb – Research Grade
PX-TA1091 200€
Biosimilar
Gantenerumab Biosimilar – Anti-APP , Abeta42, Abeta40 mAb – Research Grade
PX-TA1158 120€
Biosimilar
Solanezumab Biosimilar – Anti-APP Abeta,soluble monomer mAb – Research Grade
PX-TA1211 200€
Biosimilar
Polatuzumab Biosimilar – Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb – Research Grade
PX-TA1317 120€
Biosimilar
Trontinemab Biosimilar – Anti-APP Abeta 1-40, 42;TFRC mAb – Research Grade
PX-TA1887 200€
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.