Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

BID Protein – BH3-interacting domain death agonist(BID)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P55957
Molecular weight:
22.00 kDa

Original price was: €133.00.Current price is: €110.00.

10ug 17% OFF + 110 loyalty points
Met1–Asp195
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

BID Protein - BH3-interacting domain death agonist(BID)

Product name BID Protein - BH3-interacting domain death agonist(BID)
Uniprot ID P55957
Uniprot link https://www.uniprot.org/uniprot/P55957
Expression system Prokaryotic expression
Raw Antigen Sequence MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Molecular weight 22.00 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp195
Aliases /Synonyms p22 BID,BID
Reference PX-P4719
Note For research use only
Molecular Constructor
Met1–Asp195
Product name BID Protein - BH3-interacting domain death agonist(BID)
Uniprot ID P55957
Uniprot link https://www.uniprot.org/uniprot/P55957
Expression system Procaryotic expression
Raw Antigen Sequence MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Molecular weight 22.00 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp195
Aliases /Synonyms p22 BID,BID
Reference PX-P4719
Note For research use only
Molecular Constructor
Met1–Asp195
Product name BID Protein - BH3-interacting domain death agonist(BID)
Uniprot ID P55957
Uniprot link https://www.uniprot.org/uniprot/P55957
Expression system Prokaryotic expression
Raw Antigen Sequence MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Molecular weight 22.00 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp195
Aliases /Synonyms p22 BID,BID
Reference PX-P4719
Note For research use only
Molecular Constructor
Met1–Asp195
Product name PX-P4719-1MG
Uniprot ID P55957
Uniprot link https://www.uniprot.org/uniprot/P55957
Expression system Prokaryotic expression
Raw Antigen Sequence MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Molecular weight 22.00 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp195
Aliases /Synonyms p22 BID,BID
Reference PX-P4719
Note For research use only
Molecular Constructor
Met1–Asp195

General information on BID protein

BID protein stands for BH3 interacting-domain death antagonist. It is a pro-apoptotic member of BCL2 family of proteins. The members of the BC-2 family share at least one of the four BCL-2 homology (BH) domains also known as BH1, BH2, BH3 and B4. Based on this, members of this family of proteins can form hetero- or homodimers. Bcl-2 family of proteins are involved in a variety of cellular activities and, depending on the protein, can act as pro-apoptotic or pro-apoptotic regulators.
nnBID protein interacts with different proteins such as ATR/ATRIP, BCL2, CASP2, CASP8, MCL1 , RPA and Bax. In response to apoptotic signal, BID protein interacts with Bax which allows the insertion of Bax primarly in the outer membrane of mitochondria. It is believed that this leads to the opening voltage-dependent anion channel (VDAC) of the mitochondria. This induces the release of cytochrome c and other pro-apoptotic factors from mitochondria. This results in the activation of caspases which are a family of protease enzymes that regulate programmed cell death. The ability of BID protein to bind to Bax protein is inhibited by ant-apoptotic Bcl-2 proteins including BCl-2 protein. The latter sequesters BID proteins which results in reduced Bax protein activation.
nThe expression of BID protein are regulated by p53 tumor suppressor. The latter is a transcription factor and has been linked to the regulation of cell cycle, cell apoptosis and genomic stability. P53 is activated as a result of cell’s response to stress which induces many downstream targets including BID protein. Other apoptotic stimuli include N-hydroxy-L-arginine (NOHA), an intermediate product formed as a result of L-arginine converting to nitric oxide. The latter activates caspase 8 which in turn activates its substrate BID protein. The BID cleavage induces cytochrome-c mediated apoptosis. 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) has also been linked to the activation of caspase-8 and BID cleavage by activating caspase-9 via cytochrome-c.

SDS-PAGE for BID Protein - BH3-interacting domain death agonist(BID)

SDS-PAGE for BID Protein - BH3-interacting domain death agonist(BID)

BID Protein - BH3-interacting domain death agonist(BID), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

BID Protein - BH3-interacting domain death agonist(BID)

There are no reviews yet.

Be the first to review “BID Protein – BH3-interacting domain death agonist(BID)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products