Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human IGFBP1 Nter Recombinant Protein |
|---|---|
| Uniprot ID | P08833 |
| Uniprot link | http://www.uniprot.org/uniprot/P08833 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH |
| Molecular weight | 17.59 kD |
| Purity estimated | 85% |
| Buffer | PBS, pH 7.5 with 0.2mM β-Met |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | ACO37638.1 |
| Spec:Entrez GeneID | 3484 |
| Spec:NCBI Gene Aliases | hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25 |
| Spec:SwissProtID | P08833 |
| NCBI Reference | ACO37638.1 |
| Aliases /Synonyms | IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1 |
| Reference | PX-P2078 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.