Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade

  • PX-TA1182-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Product name Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 339986-90-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tucotuzumab,EMD 273066,KSA-Interleukin-2,huKS-IL2,huKS1/4-IL-2,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1182
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 339986-90-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tucotuzumab,EMD 273066,KSA-Interleukin-2,huKS-IL2,huKS1/4-IL-2,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1182
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1182-50
Uniprot ID P16422
Source CAS 339986-90-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tucotuzumab,EMD 273066,KSA-Interleukin-2,huKS-IL2,huKS1/4-IL-2,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1182
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb

Tucotuzumab Biosimilar is a monoclonal antibody (mAb) that targets the epithelial cell adhesion molecule (EPCAM), also known as CD326. This biosimilar is a research grade version of the original Tucotuzumab, which is a therapeutic antibody used in the treatment of various cancers.

Structure of Tucotuzumab Biosimilar

Tucotuzumab Biosimilar is a chimeric antibody, meaning it is composed of both human and mouse components. It is made up of two heavy chains and two light chains, each with a specific amino acid sequence. The heavy chains are responsible for the binding to the target, while the light chains play a role in the stability and effector functions of the antibody.

The antibody has a Y-shaped structure, with two antigen binding sites located at the tips of the Y. These binding sites are specific for the EPCAM protein, allowing Tucotuzumab Biosimilar to specifically target and bind to this protein.

Mechanism of Action

Tucotuzumab Biosimilar works by binding to the EPCAM protein on the surface of cancer cells. This binding triggers a series of events that ultimately leads to the destruction of the cancer cells.

Firstly, the binding of Tucotuzumab Biosimilar to EPCAM causes the activation of immune cells, such as natural killer cells and macrophages, which can directly kill cancer cells. Additionally, the binding of the antibody to EPCAM also blocks the signaling pathways that promote cell growth and survival, effectively inhibiting the growth and spread of cancer cells.

Applications of Tucotuzumab Biosimilar

Tucotuzumab Biosimilar has been extensively studied in preclinical and clinical trials for its potential use in cancer treatment. It has shown promising results in the treatment of various types of cancers, including colorectal, pancreatic, and breast cancer.

As a research grade antibody, Tucotuzumab Biosimilar is primarily used in laboratory settings to study the role of EPCAM in cancer and to develop potential therapies targeting this protein. It can also be used in diagnostic tests to detect the presence of EPCAM in cancer cells.

Advantages of Tucotuzumab Biosimilar

Compared to the original Tucotuzumab, the biosimilar version offers several advantages. Firstly, it is more cost-effective, making it more accessible for research purposes. Additionally, the biosimilar has a higher affinity for EPCAM, meaning it can bind more tightly to the target and potentially have a stronger therapeutic effect.

Furthermore, Tucotuzumab Biosimilar has shown a favorable safety profile in clinical trials, with minimal side effects reported. This makes it a promising candidate for further development as a cancer therapy.

Conclusion

Tucotuzumab Biosimilar is a chimeric monoclonal antibody that specifically targets the EPCAM protein on cancer cells. Its unique structure and mechanism of action make it a promising candidate for cancer treatment. As a research grade antibody, it has numerous applications in studying the role of EPCAM in cancer and developing potential therapies. With its advantages over the original Tucotuzumab, this biosimilar has the potential to make a significant impact in the field of cancer research and treatment.

Keywords: antibody, therapeutic target, Tucotuzumab Biosimilar, EPCAM, CD326, monoclonal antibody, structure, mechanism of action, applications, advantages

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade in ELISA Assay

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade in ELISA Assay

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

SDS-PAGE for Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products