Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD62L/SELL Monoclonal Antibody

  • ARO-A15777-50
  • Validated ELISA FC

Original price was: €348.00.Current price is: €274.00.

50ug 21% OFF + 274 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD62L/SELL Monoclonal Antibody binds to CD62L recombinant protein in ELISA Assay
Flow Cytometry results for Human CD62L/SELL Monoclonal Antibody
Human CD62L/SELL Monoclonal Antibody

Human CD62L/SELL Monoclonal Antibody

Product name ARO-A15777-100
Uniprot ID P14151
Uniprot link P14151
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-A15777
Isotype IgG4
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD62L/SELL
Clone Name HuDreg-55
Protein Name CD62L/SELL
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15777-1MG
Uniprot ID P14151
Uniprot link P14151
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-A15777
Isotype IgG4
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD62L/SELL
Clone Name HuDreg-55
Protein Name CD62L/SELL
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15777-50
Uniprot ID P14151
Uniprot link P14151
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-A15777
Isotype IgG4
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD62L/SELL
Clone Name HuDreg-55
Protein Name CD62L/SELL
Target species Anti-Human Monoclonal Antibody

Human CD62L/SELL Monoclonal Antibody binds to CD62L recombinant protein in ELISA Assay

Human CD62L/SELL Monoclonal Antibody binds to CD62L recombinant protein in ELISA Assay

CD62L recombinant protein(cat. No.PX-P5195) at 0.5µg/mL (100µL/well) can bind Human CD62L/SELL Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Human CD62L/SELL Monoclonal Antibody

Flow Cytometry results for Human CD62L/SELL Monoclonal Antibody

Flow-cytometry using anti-human SELL antibody. Human Jurkat cell line were stained with an irrelevant antibody (Green Histogram) or an anti-human SELL antibody monoclonal antibody (Catalog # ARO-A15777 , Red Histogram) at a concentration of 20 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human CD62L/SELL Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD62L/SELL Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products