Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CD62L recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P14151
Molecular weight:
52.82 kDa

Original price was: €352.00.Current price is: €275.00.

100ug 22% OFF + 275 loyalty points
Glu109–Ser346 N-GST
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
CD62L recombinant protein

CD62L recombinant protein

Product name PX-P5195-100
Uniprot ID P14151
Uniprot link https://www.uniprot.org/uniprot/P14151
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFS
Molecular weight 52.82 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu109-Ser346
Protein Accession P14151
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference PX-P5195
Note For research use only
Molecular Constructor
Glu109–Ser346 N-GST
Product name PX-P5195-1MG
Uniprot ID P14151
Uniprot link https://www.uniprot.org/uniprot/P14151
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFS
Molecular weight 52.82 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu109-Ser346
Protein Accession P14151
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference PX-P5195
Note For research use only
Molecular Constructor
Glu109–Ser346 N-GST
Product name PX-P5195-50
Uniprot ID P14151
Uniprot link https://www.uniprot.org/uniprot/P14151
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFS
Molecular weight 52.82 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu109-Ser346
Protein Accession P14151
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference PX-P5195
Note For research use only
Molecular Constructor
Glu109–Ser346 N-GST

CD62L recombinant protein

There are no reviews yet.

Be the first to review “CD62L recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products