Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Aselizumab Biosimilar – Anti-SELL, CD62L mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4-nd

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Aselizumab Biosimilar - Anti-SELL, CD62L mAb - Research Grade

Product name Aselizumab Biosimilar - Anti-SELL, CD62L mAb - Research Grade
Uniprot ID P14151
Source CAS 395639-53-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Aselizumab,HuDreg-55,SELL, CD62L ,anti-SELL, CD62L
Reference PX-TA1194
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-nd
Clonality Monoclonal Antibody
Product name Aselizumab Biosimilar - Anti-SELL, CD62L mAb - Research Grade
Uniprot ID P14151
Source CAS 395639-53-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Aselizumab,HuDreg-55,SELL, CD62L ,anti-SELL, CD62L
Reference PX-TA1194
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-nd
Clonality Monoclonal Antibody
Product name PX-TA1194-50
Uniprot ID P14151
Source CAS 395639-53-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Aselizumab,HuDreg-55,SELL, CD62L ,anti-SELL, CD62L
Reference PX-TA1194
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-nd
Clonality Monoclonal Antibody

Introduction

Aselizumab Biosimilar, also known as Anti-SELL or CD62L monoclonal antibody, is a promising therapeutic antibody that targets the SELL protein. SELL, also known as CD62L, is a cell adhesion molecule that plays a crucial role in the immune system by facilitating the migration of immune cells to sites of inflammation. Aselizumab Biosimilar is a research-grade antibody that has shown potential in treating various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and potential applications of Aselizumab Biosimilar.

Structure of Aselizumab Biosimilar

Aselizumab Biosimilar is a monoclonal antibody, meaning it is produced by identical immune cells that are all clones of a unique parent cell. It is a humanized antibody, meaning it is derived from non-human sources but has been modified to be more similar to human antibodies. Aselizumab Biosimilar is composed of two heavy chains and two light chains, each with a variable region and a constant region. The variable region is responsible for binding to the SELL protein, while the constant region determines the antibody’s effector functions.

Activity of Aselizumab Biosimilar

Aselizumab Biosimilar specifically targets the SELL protein, which is expressed on the surface of immune cells such as T cells, B cells, and natural killer cells. By binding to SELL, Aselizumab Biosimilar prevents the interaction between SELL and its ligand, which is necessary for immune cell migration. This blockade of SELL activity leads to a decrease in the recruitment of immune cells to sites of inflammation, thereby reducing the inflammatory response. Aselizumab Biosimilar has also been shown to modulate the function of immune cells, leading to a decrease in the production of pro-inflammatory cytokines.

Potential Applications of Aselizumab Biosimilar

Aselizumab Biosimilar has shown promising results in pre-clinical studies for the treatment of various inflammatory and autoimmune diseases. One potential application is in the treatment of multiple sclerosis (MS). SELL has been implicated in the migration of immune cells to the central nervous system, which is a key mechanism in the development of MS. By targeting SELL, Aselizumab Biosimilar may be able to reduce the infiltration of immune cells into the central nervous system, thereby slowing the progression of MS.

Another potential application of Aselizumab Biosimilar is in the treatment of rheumatoid arthritis (RA). In RA, SELL is highly expressed on the surface of immune cells, and its activity is essential for the recruitment of these cells to inflamed joints. By inhibiting SELL, Aselizumab Biosimilar may be able to reduce joint inflammation and slow the progression of RA.

In addition to MS and RA, Aselizumab Biosimilar has also shown potential in the treatment of other inflammatory diseases such as psoriasis, inflammatory bowel disease, and systemic lupus erythematosus. It may also have a role in preventing transplant rejection by inhibiting the migration of immune cells to the transplanted organ.

Conclusion

In summary, Aselizumab Biosimilar is a research-grade antibody that specifically targets the SELL protein and has shown potential in treating various inflammatory and autoimmune diseases. Its unique mechanism of action, coupled with its humanized structure, make it a promising therapeutic option for these conditions. Further clinical trials are needed to fully evaluate the safety and efficacy of Aselizumab Biosimilar, but it holds great promise in the field of immunotherapy.

SDS-PAGE for Aselizumab Biosimilar - Anti-CD62L;SELL mAb - Research Grade

SDS-PAGE for Aselizumab Biosimilar - Anti-CD62L;SELL mAb - Research Grade

Aselizumab Biosimilar - Anti-CD62L;SELL mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Aselizumab Biosimilar - Anti-SELL, CD62L  mAb - Research Grade

There are no reviews yet.

Be the first to review “Aselizumab Biosimilar – Anti-SELL, CD62L mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products