Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human CD40 ligand recombinant protein |
|---|---|
| Uniprot ID | P63304 |
| Uniprot link | http://www.uniprot.org/uniprot/P63304 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH |
| Molecular weight | 17.95kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Aliases /Synonyms | CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule |
| Reference | PX-P4016 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.