Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

hSAss-TwinStrep-MYBPHL_iso (MYBPHL)

Host species:
Mammalian cells
Uniprot ID:
A2RUH7
Molecular weight:
41.34KDa

210.00

50ug + 210 loyalty points
Met1–Asn354
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

hSAss-TwinStrep-MYBPHL_iso (MYBPHL)

Product name hSAss-TwinStrep-MYBPHL_iso (MYBPHL)
Uniprot ID A2RUH7
Uniprot link https://www.uniprot.org/uniprot/A2RUH7
Expression system Eukaryotic expression
Sequence MKWVTFISLLFLFSSAYSASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADSERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Molecular weight 41.34KDa
Purity estimated 40% by SDS-PAGE
Buffer 50mM Tris-Cl pH 7.5, 150mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn354
Aliases /Synonyms MYBPHL/Myosin-binding protein H-like
Reference PX-P4387
Note For research use only
Molecular Constructor
Met1–Asn354
Product name hSAss-TwinStrep-MYBPHL_iso (MYBPHL)
Uniprot ID A2RUH7
Uniprot link https://www.uniprot.org/uniprot/A2RUH7
Expression system Eukaryotic expression
Sequence MKWVTFISLLFLFSSAYSASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADSERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Molecular weight 41.34KDa
Purity estimated 40% by SDS-PAGE
Buffer 50mM Tris-Cl pH 7.5, 150mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn354
Aliases /Synonyms MYBPHL/Myosin-binding protein H-like
Reference PX-P4387
Note For research use only
Molecular Constructor
Met1–Asn354

There are no reviews yet.

Be the first to review “hSAss-TwinStrep-MYBPHL_iso (MYBPHL)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products