Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD160 antigen (1-179)

Host species:
Mammalian cells
Uniprot ID:
O95971
Molecular weight:
22.52kDa

Original price was: €306.00.Current price is: €259.00.

50ug 15% OFF + 259 loyalty points
Mer1–Gln179 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD160 antigen (1-179)

Product name CD160 antigen (1-179)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Mer1-Gln179
Protein Accession O95971
Spec:Entrez GeneID 11126
Spec:NCBI Gene Aliases NK1; BY55; NK28
Spec:SwissProtID Q5T2V6
NCBI Reference O95971
Aliases /Synonyms Natural killer cell receptor BY55 / CD_antigen: CD160
Reference PX-P4469
Note For research use only
Molecular Constructor
Mer1–Gln179 His
Product name CD160 antigen (1-179)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Mer1-Gln179
Protein Accession O95971
Spec:Entrez GeneID 11126
Spec:NCBI Gene Aliases NK1; BY55; NK28
Spec:SwissProtID Q5T2V6
NCBI Reference O95971
Aliases /Synonyms Natural killer cell receptor BY55 / CD_antigen: CD160
Reference PX-P4469
Note For research use only
Molecular Constructor
Mer1–Gln179 His
Product name PX-P4469-1MG
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Mer1-Gln179
Protein Accession O95971
Spec:Entrez GeneID 11126
Spec:NCBI Gene Aliases NK1; BY55; NK28
Spec:SwissProtID Q5T2V6
NCBI Reference O95971
Aliases /Synonyms Natural killer cell receptor BY55 / CD_antigen: CD160
Reference PX-P4469
Note For research use only
Molecular Constructor
Mer1–Gln179 His

CD160 antigen (1-179)

There are no reviews yet.

Be the first to review “CD160 antigen (1-179)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products