Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gumokimab Biosimilar – Anti-IL17 mAb – Research Grade

  • PX-TA1767-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €339.00.Current price is: €259.00.

50ug 24% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

Product name Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2428381-52-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gumokimab,AK 111, AK-111, AK111,IL17,anti-IL17
Reference PX-TA1767
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2428381-52-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gumokimab,AK 111, AK-111, AK111,IL17,anti-IL17
Reference PX-TA1767
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1767-50
Uniprot ID Q16552
Source CAS: 2428381-52-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gumokimab,AK 111, AK-111, AK111,IL17,anti-IL17
Reference PX-TA1767
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Gumokimab Biosimilar – Anti-IL17 mAb

Gumokimab Biosimilar – Anti-IL17 mAb is a monoclonal antibody (mAb) that has been developed as a biosimilar to the original drug, Gumokimab. It is designed to target and inhibit the activity of interleukin-17 (IL-17), a cytokine involved in various inflammatory and autoimmune diseases. In this article, we will explore the structure, activity, and potential applications of Gumokimab Biosimilar in research.

Structure of Gumokimab Biosimilar

Gumokimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a variable region that binds specifically to IL-17, and a constant region that mediates effector functions.

Activity of Gumokimab Biosimilar

Gumokimab Biosimilar exerts its activity by binding to IL-17, a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various diseases. IL-17 is produced by a variety of immune cells, including T cells, and is involved in the recruitment and activation of other immune cells, leading to tissue inflammation. By binding to IL-17, Gumokimab Biosimilar blocks its interaction with its receptor and inhibits its downstream signaling, thereby reducing inflammation.

Therapeutic Target of Gumokimab Biosimilar

The therapeutic target of Gumokimab Biosimilar is IL-17, making it a potential treatment for diseases where IL-17 plays a significant role. These include psoriasis, psoriatic arthritis, ankylosing spondylitis, rheumatoid arthritis, and inflammatory bowel disease. IL-17 has also been implicated in other autoimmune and inflammatory conditions, such as multiple sclerosis, asthma, and lupus. Therefore, Gumokimab Biosimilar has the potential to be a valuable therapeutic option for a wide range of diseases.

Title: Applications of Gumokimab Biosimilar in Research

Gumokimab Biosimilar is currently in the research stage and is not yet approved for clinical use. However, it has shown promising results in preclinical studies and is being evaluated for its potential applications in various diseases. In addition to its potential as a therapeutic agent, Gumokimab Biosimilar can also be used in research to study the role of IL-17 in disease pathogenesis and to develop new treatment strategies.

Advantages of Gumokimab Biosimilar

As a biosimilar, Gumokimab Biosimilar offers several advantages over the original drug, Gumokimab. It is produced using recombinant DNA technology, ensuring a consistent and high-quality product. It also has a lower cost compared to the original drug, making it more accessible for researchers. Moreover, as a biosimilar, it has been shown to have comparable efficacy and safety to the original drug, making it a promising alternative for IL-17-targeted therapy.

Conclusion

In conclusion, Gumokimab Biosimilar – Anti-IL17 mAb is a promising monoclonal antibody that targets IL-17 and has the potential to be a valuable therapeutic option for various inflammatory and autoimmune diseases. Its structure, activity, and potential applications make it a valuable tool for research in understanding the role of IL-17 in disease pathogenesis and developing new treatments. With its advantages as a biosimilar, Gumokimab Biosimilar has the potential to improve patient outcomes and contribute to the advancement of IL-17-targeted therapy.

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

SDS-PAGE for Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Gumokimab Biosimilar - Anti-IL17 mAb - Research Grade

There are no reviews yet.

Be the first to review “Gumokimab Biosimilar – Anti-IL17 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products