Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Farletuzumab Biosimilar – Anti-FOLR1 mAb – Research Grade

  • PX-TA1207-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade

Product name Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 896723-44-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Molecular weight 30kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Farletuzumab,M3,MORAb-003,FOLR1 ,anti-FOLR1
Reference PX-TA1207
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 896723-44-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Molecular weight 30kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Farletuzumab,M3,MORAb-003,FOLR1 ,anti-FOLR1
Reference PX-TA1207
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1207-50
Uniprot ID P15328
Source CAS 896723-44-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Molecular weight 30kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Farletuzumab,M3,MORAb-003,FOLR1 ,anti-FOLR1
Reference PX-TA1207
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

The Structure of Farletuzumab Biosimilar – Anti-FOLR1 mAb

Farletuzumab Biosimilar, also known as Anti-FOLR1 monoclonal antibody (mAb), is a therapeutic antibody that specifically targets the folate receptor alpha (FOLR1) protein. It is a biosimilar version of the original Farletuzumab, which has been developed to have the same structure and function as the original antibody.

The structure of Farletuzumab Biosimilar is similar to other monoclonal antibodies, consisting of two heavy chains and two light chains that are connected by disulfide bonds. The heavy chains are around 50 kDa in size and the light chains are around 25 kDa, resulting in a total molecular weight of approximately 150 kDa.

The variable regions of the heavy and light chains are responsible for the specificity of Farletuzumab Biosimilar, as they contain the antigen-binding sites that recognize and bind to the FOLR1 protein. The constant regions of the antibody are responsible for mediating the effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The Activity of Farletuzumab Biosimilar – Anti-FOLR1 mAb

The main activity of Farletuzumab Biosimilar is to bind to the FOLR1 protein, which is overexpressed in various types of cancer cells. This binding leads to the inhibition of cancer cell growth and survival, making Farletuzumab Biosimilar a promising therapeutic agent for the treatment of cancer.

In addition to its direct anti-tumor activity, Farletuzumab Biosimilar also has the ability to activate the immune system through its effector functions. This can enhance the body’s natural defense mechanisms against cancer cells, leading to a more effective and targeted treatment approach.

Studies have shown that Farletuzumab Biosimilar has a high affinity and specificity for FOLR1, making it a potent and selective therapeutic agent. It has also been shown to have low immunogenicity, meaning it is less likely to cause an immune response in patients.

The Application of Farletuzumab Biosimilar – Anti-FOLR1 mAb

Farletuzumab Biosimilar is currently being investigated as a potential treatment for various types of cancer, including ovarian, lung, and breast cancer. It is typically used in combination with other cancer therapies, such as chemotherapy, to enhance its anti-tumor effects.

One of the main advantages of Farletuzumab Biosimilar is its biosimilarity to the original Farletuzumab, which has already been extensively studied in clinical trials. This allows for a faster and more streamlined development process, potentially leading to quicker availability of this therapeutic option for cancer patients.

In addition to its potential as a cancer treatment, Farletuzumab Biosimilar is also being explored as a diagnostic tool. Due to its high specificity for FOLR1, it can be used to detect the presence of FOLR1 in cancer cells, allowing for more accurate and targeted diagnosis of certain types of cancer.

In conclusion, Farletuzumab Biosimilar – Anti-FOLR1 mAb is a promising therapeutic option for the treatment of cancer. Its specific structure and activity make it a potent and selective agent, with the potential to enhance the body’s natural defense mechanisms against cancer cells. With ongoing research and clinical trials, Farletuzumab Biosimilar may soon become a valuable addition to the arsenal of cancer treatments.

SDS-PAGE for Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade

SDS-PAGE for Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade

Farletuzumab Biosimilar - Anti-FOLR1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Farletuzumab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Farletuzumab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Immobilized FOLR1 recombinant protein (cat. No.PX-P5197) at 0.5µg/mL (100µL/well) can bind to Farletuzumab Biosimilar - Anti-FOLR1 mAb (cat. No.PX-TA1207) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Farletuzumab Biosimilar - Anti-FOLR1  mAb - Research Grade

There are no reviews yet.

Be the first to review “Farletuzumab Biosimilar – Anti-FOLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products