Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mirvetuximab Biosimilar – Anti-FOLR1 mAb – Research Grade

  • PX-TA1412-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay
SDS-PAGE for Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade
Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

Product name Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 1453084-36-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mirvetuximab,M9346A,FOLR1,anti-FOLR1
Reference PX-TA1412
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 1453084-36-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mirvetuximab,M9346A,FOLR1,anti-FOLR1
Reference PX-TA1412
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1412-50
Uniprot ID P15328
Source CAS 1453084-36-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mirvetuximab,M9346A,FOLR1,anti-FOLR1
Reference PX-TA1412
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-FOLR1[Homo sapiens] (Mirvetuximab) Monoclonal Antibody

Mirvetuximab is monoclonal antibody that targets folate receptor alpha (FR alpha). It has been used in ADC form to treat cancers.

Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Immobilized FOLR1 recombinant protein (cat. No.PX-P5197) at 0.5µg/mL (100µL/well) can bind to Mirvetuximab Biosimilar - Anti-FOLR1 mAb (cat. No.PX-TA1412) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

SDS-PAGE for Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Mirvetuximab Biosimilar – Anti-FOLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products