Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Farletuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Farletuzumab ELISA Kit

Farletuzumab ELISA Kit

Product name Farletuzumab ELISA Kit
Uniprot ID P15328
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX185
Note For research use only.
Sample type Plasma, Serum
Target Farletuzumab
Immunogen Farletuzumab

Introduction to Farletuzumab ELISA Kit

Farletuzumab is a humanized monoclonal antibody that specifically targets the folate receptor alpha (FRα). This receptor is overexpressed in a variety of solid tumors, making it a promising therapeutic target for cancer treatment. The Farletuzumab ELISA Kit is a powerful tool for detecting and quantifying this antibody in biological samples. In this article, we will discuss the structure, activity, and application of the Farletuzumab ELISA Kit.

Structure of Farletuzumab ELISA Kit

The Farletuzumab ELISA Kit is composed of several components, including a microplate coated with FRα antigen, a standard solution of known concentration of Farletuzumab, and detection reagents. The microplate is typically made of polystyrene and is divided into multiple wells, each of which can accommodate a small volume of the sample. The FRα antigen is immobilized on the surface of the microplate, allowing for specific binding of Farletuzumab.

Activity of Farletuzumab ELISA Kit

The activity of the Farletuzumab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA). This technique utilizes the specific binding of an antibody to its target antigen, which is then detected using an enzyme-linked secondary antibody. In the case of the Farletuzumab ELISA Kit, the primary antibody is Farletuzumab and the secondary antibody is conjugated to an enzyme such as horseradish peroxidase (HRP). When the sample is added to the microplate, any Farletuzumab present in the sample will bind to the FRα antigen on the plate. The addition of the HRP-conjugated secondary antibody and a substrate for the enzyme will result in a color change, which can be measured using a spectrophotometer. The intensity of the color is directly proportional to the amount of Farletuzumab present in the sample, allowing for accurate quantification.

Application of Farletuzumab ELISA Kit

The Farletuzumab ELISA Kit has a wide range of applications in both research and clinical settings. It is commonly used to measure the levels of Farletuzumab in serum, plasma, and other biological samples. This can provide valuable information about the pharmacokinetics and pharmacodynamics of the antibody, as well as its potential efficacy as a therapeutic agent. Additionally, the Farletuzumab ELISA Kit can be used to monitor the response of patients to Farletuzumab treatment, as well as to assess the presence of anti-drug antibodies that may affect treatment efficacy.

Furthermore, the Farletuzumab ELISA Kit can also be used in the development of new therapeutic agents targeting FRα. By measuring the binding affinity and specificity of potential drugs to FRα using the Farletuzumab ELISA Kit, researchers can identify promising candidates for further development.

Conclusion

In summary, the Farletuzumab ELISA Kit is a valuable tool for detecting and quantifying Farletuzumab, a promising therapeutic antibody targeting FRα. Its structure, activity, and application make it an essential component in the development and evaluation of Farletuzumab-based therapies. With its high sensitivity and specificity, the Farletuzumab ELISA Kit is a crucial asset in the fight against cancer and the search for new and effective treatments.

Farletuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Farletuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products