Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Falbikitug Biosimilar – Anti-Emfilermin mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade

Product name Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade
Uniprot ID P15018
Source CAS: 2740565-02-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Emfilermin, D factor, HILDA, LIF, MLPLI, Melanoma-derived LPL inhibitor, Leukemia inhibitory factor, Differentiation-stimulating factor
Reference PX-TA1947
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade
Uniprot ID P15018
Source CAS: 2740565-02-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Emfilermin, D factor, HILDA, LIF, MLPLI, Melanoma-derived LPL inhibitor, Leukemia inhibitory factor, Differentiation-stimulating factor
Reference PX-TA1947
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1947-50
Uniprot ID P15018
Source CAS: 2740565-02-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Emfilermin, D factor, HILDA, LIF, MLPLI, Melanoma-derived LPL inhibitor, Leukemia inhibitory factor, Differentiation-stimulating factor
Reference PX-TA1947
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Falbikitug Biosimilar: A Revolutionary Anti-Emfilermin mAb

Falbikitug Biosimilar is a cutting-edge therapeutic antibody that has gained significant attention in the field of biopharmaceuticals. It is a biosimilar version of the well-known drug, Emfilermin, which has been widely used for the treatment of various diseases. This biosimilar is a highly potent and specific monoclonal antibody (mAb) that targets the protein Emfilermin, also known as fibroblast growth factor 19 (FGF19). In this article, we will delve deeper into the structure, activity, and applications of Falbikitug Biosimilar.

Structure of Falbikitug Biosimilar

Falbikitug Biosimilar is a recombinant humanized IgG1κ monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for the high specificity and binding affinity of the antibody towards its target, Emfilermin. The constant region, on the other hand, plays a crucial role in the antibody’s effector functions, such as complement activation and antibody-dependent cellular cytotoxicity.

The amino acid sequence of Falbikitug Biosimilar is highly similar to that of the originator drug, Emfilermin. This is due to the advanced technology used in its production, which ensures that the biosimilar has the same primary, secondary, and tertiary structure as the reference product. The similarity in structure also translates to similar pharmacokinetic and pharmacodynamic properties, making Falbikitug Biosimilar a reliable alternative to the reference drug.

Activity of Falbikitug Biosimilar

As mentioned earlier, Falbikitug Biosimilar specifically targets Emfilermin, a protein that plays a crucial role in regulating bile acid and lipid metabolism. Emfilermin is also known to have potent anti-inflammatory and anti-apoptotic effects, making it a potential therapeutic target for various diseases.

By binding to Emfilermin, Falbikitug Biosimilar inhibits its activity and disrupts the signaling pathways involved in bile acid and lipid metabolism. This leads to a decrease in bile acid synthesis and an increase in lipid metabolism, which can help in the treatment of diseases such as non-alcoholic fatty liver disease (NAFLD) and primary biliary cholangitis (PBC).

Moreover, the anti-inflammatory and anti-apoptotic effects of Emfilermin make Falbikitug Biosimilar a promising candidate for the treatment of inflammatory bowel disease (IBD) and other autoimmune disorders. By blocking Emfilermin, Falbikitug Biosimilar can reduce inflammation and cell death, providing relief to patients suffering from these conditions.

Applications of Falbikitug Biosimilar

Falbikitug Biosimilar is currently being evaluated in clinical trials for the treatment of various diseases, including NAFLD, PBC, and IBD. Its high specificity and similarity to the reference drug make it a promising alternative for patients who do not respond well to the originator drug or cannot afford it.

In addition to its therapeutic applications, Falbikitug Biosimilar also has potential in research and development. Its high specificity towards Emfilermin makes it a valuable tool for studying the role of this protein in different diseases. It can also be used in preclinical studies to evaluate the efficacy and safety of potential Emfilermin-targeting drugs.

Conclusion

Falbikitug Biosimilar is a revolutionary anti-Emfilermin mAb that has the potential to transform the treatment of various diseases. Its highly similar structure and activity to the reference drug, along with its promising applications, make it a strong contender in the biopharmaceutical market. With ongoing clinical trials and further research, Falbikitug Biosimilar is expected to make a significant impact in the field of bi

SDS-PAGE for Research Grade Falbikitug

SDS-PAGE for Research Grade Falbikitug

Research Grade Falbikitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade

There are no reviews yet.

Be the first to review “Falbikitug Biosimilar – Anti-Emfilermin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products