Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Drosophila TIO Recombinant Protein |
---|---|
Uniprot ID | Q9U3V5 |
Uniprot link | http://www.uniprot.org/uniprot/Q9U3V5 |
Origin species | Drosophila |
Expression system | Prokaryotic expression |
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSSTASATLP SANGNDLVAFSWACNEAVLSASNGGSAGDSSIIKCSYCDTPFASKGAYRHHLSKVHFVKDAGEDSPRLKSPAVQSPRSMP LASPRRSASRSPATGSQQPPPSPTISPYDESPQSKFLKYTELAKQLSSKNA |
Molecular weight | 41,43 kDa |
Protein delivered with Tag? | No |
Purity estimated | 60% |
Buffer | Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7 |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Partial |
Protein Accession | NP_524733.2 |
Spec:Entrez GeneID | 44272 |
Spec:NCBI Gene Aliases | Tio, DmelCG12630, CG12630 |
Spec:SwissProtID | Q9U3V5 |
NCBI Reference | NP_524733.2 |
Aliases /Synonyms | TIO, tiptop, isoform A |
Reference | PX-P1162 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.