Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Drosophila TIO Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Drosophila TIO Recombinant Protein |
|---|---|
| Uniprot ID | Q9U3V5 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9U3V5 |
| Origin species | Drosophila |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSSTASATLP SANGNDLVAFSWACNEAVLSASNGGSAGDSSIIKCSYCDTPFASKGAYRHHLSKVHFVKDAGEDSPRLKSPAVQSPRSMP LASPRRSASRSPATGSQQPPPSPTISPYDESPQSKFLKYTELAKQLSSKNA |
| Molecular weight | 41,43 kDa |
| Protein delivered with Tag? | No |
| Purity estimated | 60% |
| Buffer | Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7 |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | NP_524733.2 |
| Spec:Entrez GeneID | 44272 |
| Spec:NCBI Gene Aliases | Tio, DmelCG12630, CG12630 |
| Spec:SwissProtID | Q9U3V5 |
| NCBI Reference | NP_524733.2 |
| Aliases /Synonyms | TIO, tiptop, isoform A |
| Reference | PX-P1162 |
| Note | For research use only |
Related products
Biosimilar
Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade
PX-TA1318 200€
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.