Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Crefmirlimab Biosimilar – Anti-CD8A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

Product name Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade
Uniprot ID P01732
Species scFv Engineered Dimer
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Crefmirlimab,,CD8A,anti-CD8A
Reference PX-TA1828
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade
Uniprot ID P01732
Species scFv Engineered Dimer
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Crefmirlimab,,CD8A,anti-CD8A
Reference PX-TA1828
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1828-50
Uniprot ID P01732
Species scFv Engineered Dimer
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Crefmirlimab,,CD8A,anti-CD8A
Reference PX-TA1828
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Crefmirlimab Biosimilar, also known as Anti-CD8A monoclonal antibody (mAb), is a research grade therapeutic antibody that targets the CD8A protein. This protein is found on the surface of T cells, a type of immune cell that plays a crucial role in the body’s defense against infections and diseases. Crefmirlimab Biosimilar has been developed as a potential treatment for various diseases, and its structure, activity, and applications will be discussed in this article.

Structure of Crefmirlimab Biosimilar

Crefmirlimab Biosimilar is a type of monoclonal antibody, which means it is produced by cloning a single immune cell to create identical copies. It is a humanized antibody, meaning it is derived from non-human sources but has been modified to be more similar to human antibodies. This reduces the risk of adverse reactions in patients.

The antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. These chains are made up of amino acids and have a specific sequence that determines their unique structure and function. The variable regions of the antibody, located at the tips of the heavy and light chains, are responsible for binding to the CD8A protein.

Activity of Crefmirlimab Biosimilar

Crefmirlimab Biosimilar works by binding to the CD8A protein on the surface of T cells. This binding triggers a series of events that activate the T cells, leading to their proliferation and differentiation into effector cells. These effector cells then carry out their functions, such as killing infected or abnormal cells, to protect the body from disease.

In addition to activating T cells, Crefmirlimab Biosimilar also has the ability to modulate the immune response. It can induce the production of cytokines, which are signaling molecules that regulate the immune system. This can help to enhance the body’s immune response against diseases.

Applications of Crefmirlimab Biosimilar

Crefmirlimab Biosimilar has shown promising results in preclinical studies for the treatment of various diseases. Its ability to activate T cells and modulate the immune response makes it a potential therapeutic option for a wide range of conditions.

One of the main applications of Crefmirlimab Biosimilar is in the treatment of cancer. CD8A is overexpressed on the surface of tumor-infiltrating T cells, and by targeting this protein, Crefmirlimab Biosimilar can activate these T cells to attack and kill cancer cells. Clinical trials are currently underway to evaluate its efficacy in different types of cancer, including melanoma, lung cancer, and head and neck cancer.

Another potential application of Crefmirlimab Biosimilar is in the treatment of autoimmune diseases. By modulating the immune response, this antibody can help to control the overactive immune system that causes these diseases. It has shown promising results in preclinical studies for the treatment of rheumatoid arthritis and multiple sclerosis.

Conclusion

Crefmirlimab Biosimilar is a research grade therapeutic antibody that targets the CD8A protein. Its structure, activity, and applications make it a promising candidate for the treatment of various diseases, particularly cancer and autoimmune diseases. Further research and clinical trials are needed to fully understand its potential and to bring this antibody to the market for the benefit of patients.

SDS-PAGE for Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

SDS-PAGE for Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Crefmirlimab Biosimilar - Anti-CD8A mAb - Research Grade

There are no reviews yet.

Be the first to review “Crefmirlimab Biosimilar – Anti-CD8A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products