Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

CD40 ligand(CD40LG)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameCD40 ligand(CD40LG)
Uniprot IDP29965
Uniprot linkhttps://www.uniprot.org/uniprot/P29965
Expression systemProkaryotic expression
SequenceMENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight18kDa
Protein delivered with Tag?C-terminal His Tag
Purity estimated>80% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeGlu108-Leu261
Protein AccessionP29965
Spec:Entrez GeneID959
Spec:NCBI Gene AliasesIGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
NCBI ReferenceP29965
Aliases /SynonymsCD40-L,T-cell antigen Gp39,TNF-related activation protein,TRAP,Tumor necrosis factor ligand superfamily member 5,CD_antigen: CD154,CD40L, TNFSF5, TRAP
ReferencePX-P4855
NoteFor research use only

Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb binds to CD40 ligand(CD40LG) in indirect ELISA Assay

Immobilized CD40 ligand(CD40LG) (cat. No.PX-P4855) at 0.5µg/mL (100µL/well) can bind to Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb (cat. No.PX-TA1459) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD40 ligand(CD40LG)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products