Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rosopatamab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Rosopatamab ELISA Kit

Rosopatamab ELISA Kit

Product name Rosopatamab ELISA Kit
Uniprot ID Q04609
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX239
Note For research use only.
Sample type Plasma, Serum
Target Rosopatamab
Immunogen Rosopatamab

The Structure of Rosopatamab ELISA Kit

Rosopatamab ELISA Kit is a highly specialized and sensitive diagnostic tool used in the detection and quantification of the antibody known as Rosopatamab. This kit is designed to specifically target and measure the levels of Rosopatamab in various biological samples, making it a valuable tool in both research and clinical settings.

The structure of the Rosopatamab ELISA Kit consists of several components, each playing a crucial role in the accurate and precise detection of the antibody. These components include a microplate coated with a specific antigen, a primary and secondary antibody, and a chromogenic substrate.

The Role of the Antigen

The microplate used in the Rosopatamab ELISA Kit is coated with a specific antigen that is designed to bind specifically to the Rosopatamab antibody. This antigen is carefully selected and optimized to ensure high sensitivity and specificity in the detection of Rosopatamab. The antigen is immobilized on the surface of the microplate, providing a solid support for the antibody-antigen interaction.

The Antibodies: Primary and Secondary

The primary antibody used in the Rosopatamab ELISA Kit is a monoclonal antibody that is highly specific to Rosopatamab. This antibody is labeled with an enzyme, such as horseradish peroxidase (HRP), which acts as a reporter molecule in the detection process. The primary antibody binds to the antigen on the microplate, forming an antigen-antibody complex.

The secondary antibody is a polyclonal antibody that is also specific to Rosopatamab. This antibody is labeled with a different enzyme, such as alkaline phosphatase (AP). The secondary antibody binds to the primary antibody, forming a sandwich complex with the antigen-antibody complex.

The Chromogenic Substrate

The chromogenic substrate is the final component of the Rosopatamab ELISA Kit. This substrate is added after the antigen-antibody-enzyme complex has formed. The enzyme labels on the primary and secondary antibodies catalyze a reaction with the chromogenic substrate, resulting in a color change. The intensity of the color is directly proportional to the amount of Rosopatamab present in the sample.

The Activity of Rosopatamab ELISA Kit

The Rosopatamab ELISA Kit is a highly sensitive and specific diagnostic tool that utilizes the principle of enzyme-linked immunosorbent assay (ELISA). This technique allows for the detection and quantification of Rosopatamab in various biological samples, including serum, plasma, and cell culture supernatant.

The activity of the Rosopatamab ELISA Kit is based on the specific binding of the Rosopatamab antibody to the antigen on the microplate. This binding is then amplified by the secondary antibody, resulting in a sandwich complex that can be visualized through the color change of the chromogenic substrate.

The Application of Rosopatamab ELISA Kit

Rosopatamab is a therapeutic target that has been identified as a potential treatment for various autoimmune diseases, such as rheumatoid arthritis and lupus. The Rosopatamab ELISA Kit is a valuable tool in the development and evaluation of this antibody as a potential therapy.

In research settings, the Rosopatamab ELISA Kit can be used to measure the levels of Rosopatamab in different biological samples, providing valuable insights into the efficacy and pharmacokinetics of the antibody. In clinical settings, the kit can be used to diagnose and monitor the levels of Rosopatamab in patients receiving treatment.

In addition to its application in the development and evaluation of Rosopatamab, the Rosopatamab ELISA Kit can also be used in the detection of Rosopatamab in other contexts, such as in the assessment of immune responses to infections or in the detection of autoantibodies in autoimmune diseases.

In

Rosopatamab ELISA Kit

There are no reviews yet.

Be the first to review “Rosopatamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products