Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brenetafusp Biosimilar – Anti-HLAA fusion protein – Research Grade

Uniprot ID:
P04439 & P07766

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade

Product name Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade
Uniprot ID P04439 & P07766
Source CAS: 2736407-54-6
Expression system XtenCHO
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLAA, Human leukocyte antigen A, HLA class I histocompatibility antigen, A alpha chain, HLA-A, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1984
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv - fused to a human T-cell receptor beta chain disulfide bridged to a human T cell receptor alpha chain.
Product name Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade
Uniprot ID P04439 & P07766
Source CAS: 2736407-54-6
Expression system XtenCHO
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLAA, Human leukocyte antigen A, HLA class I histocompatibility antigen, A alpha chain, HLA-A, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1984
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv - fused to a human T-cell receptor beta chain disulfide bridged to a human T cell receptor alpha chain.
Product name PX-TA1984-50
Uniprot ID P04439 & P07766
Source CAS: 2736407-54-6
Expression system XtenCHO
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLAA, Human leukocyte antigen A, HLA class I histocompatibility antigen, A alpha chain, HLA-A, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1984
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv - fused to a human T-cell receptor beta chain disulfide bridged to a human T cell receptor alpha chain.

Introduction to Brenetafusp Biosimilar – Anti-HLAA Fusion Protein

What is Brenetafusp Biosimilar?

Brenetafusp Biosimilar is a novel therapeutic protein that has been developed as a biosimilar version of the anti-HLAA fusion protein. This fusion protein is a type of antibody that has been engineered to target a specific protein called HLAA, which is found on the surface of cancer cells. Brenetafusp Biosimilar is a research grade version of this protein, meaning it is primarily used for scientific research and development purposes.

Structure of Brenetafusp Biosimilar

Brenetafusp Biosimilar is a fusion protein composed of two parts: the anti-HLAA antibody and a bacterial toxin known as Pseudomonas exotoxin A. The anti-HLAA antibody is a type of immunoglobulin G (IgG) molecule, which is a Y-shaped protein that is produced by the immune system to recognize and bind to specific targets. In this case, the anti-HLAA antibody has been designed to bind to HLAA, a protein that is overexpressed on the surface of cancer cells.

The other component of Brenetafusp Biosimilar, Pseudomonas exotoxin A, is a potent bacterial toxin that is capable of killing cells by disrupting their protein synthesis machinery. This toxin has been modified to be inactive until it is cleaved by an enzyme called furin, which is found in high levels on the surface of cancer cells. Once activated, Pseudomonas exotoxin A is able to enter the cancer cells and kill them from within.

Activity of Brenetafusp Biosimilar

The main activity of Brenetafusp Biosimilar is its ability to selectively target and kill cancer cells that express HLAA. This is achieved through the specific binding of the anti-HLAA antibody to HLAA on the surface of cancer cells, followed by the activation of Pseudomonas exotoxin A and subsequent cell death. This targeted approach minimizes the potential side effects of traditional cancer treatments, which often harm healthy cells along with cancerous ones.

In addition to its cytotoxic activity, Brenetafusp Biosimilar also has immunomodulatory effects. The anti-HLAA antibody component of the fusion protein can activate the immune system to recognize and attack cancer cells. This can enhance the efficacy of the treatment and potentially lead to long-term remission.

Applications of Brenetafusp Biosimilar

Brenetafusp Biosimilar is primarily used in scientific research and development, particularly in the field of cancer immunotherapy. Its unique structure and activity make it a promising candidate for the treatment of various types of cancer, including melanoma, breast cancer, and lung cancer. In addition, Brenetafusp Biosimilar has the potential to be used in combination with other cancer treatments to improve their efficacy.

Furthermore, Brenetafusp Biosimilar can also be used as a tool in laboratory experiments to study the role of HLAA in cancer and to develop new therapies targeting this protein. Its research grade status allows for the production of large quantities of the protein for use in various scientific studies.

Conclusion

Brenetafusp Biosimilar is a novel fusion protein with a unique structure and activity. Its ability to specifically target and kill cancer cells while also modulating the immune system makes it a promising candidate for the treatment of various types of cancer. Its research grade status also allows for its use in scientific research and development, furthering our understanding of cancer and potential treatments. With ongoing research and development, Brenetafusp Biosimilar has the potential to make a significant impact in the fight against cancer.

SDS-PAGE for Research Grade Brenetafusp

SDS-PAGE for Research Grade Brenetafusp

Research Grade Brenetafusp, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Brenetafusp Biosimilar - Anti-HLAA fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Brenetafusp Biosimilar – Anti-HLAA fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products