Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Atibuclimab Biosimilar – Anti-CD14 mAb – Research Grade

  • PX-TA1811-50
  • Validated ELISA
Isotype:
IgG4, Kappa

Original price was: €106.00.Current price is: €84.00.

50ug 21% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

Product name PX-TA1811-50
Uniprot ID P08571
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa

Introduction to Atibuclimab Biosimilar – Anti-CD14 mAb

Atibuclimab Biosimilar, also known as Anti-CD14 mAb, is a monoclonal antibody that has gained attention in the field of immunotherapy due to its potential as a therapeutic agent for various diseases. In this article, we will explore the structure, activity, and application of Atibuclimab Biosimilar in research grade.

Structure of Atibuclimab Biosimilar

Atibuclimab Biosimilar is a recombinant humanized monoclonal antibody that targets the CD14 protein. It is composed of two heavy chains and two light chains, each containing specific domains that are essential for its function. The heavy chain consists of a variable region, which recognizes and binds to the CD14 protein, and a constant region, which is responsible for the effector functions of the antibody. The light chain also contains a variable region and a constant region, which contribute to the overall stability and specificity of the antibody.

Activity of Atibuclimab Biosimilar

Atibuclimab Biosimilar specifically targets the CD14 protein, which is a co-receptor for Toll-like receptors (TLRs) and plays a crucial role in the innate immune response. By binding to CD14, Atibuclimab Biosimilar blocks the activation of TLRs, thereby inhibiting the downstream signaling pathways involved in inflammation and immune response. This mechanism of action makes Atibuclimab Biosimilar a promising therapeutic agent for diseases characterized by excessive inflammation, such as sepsis, rheumatoid arthritis, and inflammatory bowel disease.

Application of Atibuclimab Biosimilar

Atibuclimab Biosimilar is currently being studied as a potential treatment for various diseases, with a focus on its anti-inflammatory properties. In preclinical studies, it has shown promising results in reducing inflammation and improving disease outcomes in animal models of sepsis, rheumatoid arthritis, and inflammatory bowel disease. Additionally, Atibuclimab Biosimilar has been shown to have a good safety profile in these studies, making it a potentially safe and effective treatment option for patients.

Therapeutic Target: CD14

CD14 is a glycosylphosphatidylinositol (GPI)-anchored protein that is expressed on the surface of various immune cells, including monocytes, macrophages, and dendritic cells. It acts as a co-receptor for TLRs, which are key players in the innate immune response. CD14 plays a critical role in the recognition of pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs) by TLRs, leading to the activation of immune cells and the production of pro-inflammatory cytokines. However, excessive activation of TLRs and subsequent inflammation can contribute to the development and progression of various diseases. By targeting CD14, Atibuclimab Biosimilar can modulate the activity of TLRs and reduce inflammation, making it a potential therapeutic target for diseases characterized by dysregulated immune response.

Conclusion

Atibuclimab Biosimilar, also known as Anti-CD14 mAb, is a promising monoclonal antibody that targets the CD14 protein and has shown potential as a therapeutic agent for various diseases. Its structure, activity, and application make it a promising candidate for the treatment of diseases characterized by excessive inflammation. Further research and clinical trials are needed to fully understand the potential of Atibuclimab Biosimilar and its role in immunotherapy.

SDS-PAGE for Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

SDS-PAGE for Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade binds to Human CD14 recombinant protein in ELISA Assay

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade binds to Human CD14 recombinant protein in ELISA Assay

Human CD14 recombinant protein(cat. No.PX-P6553) at 0.5µg/mL (100µL/well) can bind Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

There are no reviews yet.

Be the first to review “Atibuclimab Biosimilar – Anti-CD14 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products