Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD14 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P08571
Molecular weight:
35.09 kDa

Original price was: €192.00.Current price is: €167.00.

50ug 13% OFF + 167 loyalty points
Fc Thr20–Ala83
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD14 recombinant protein

Human CD14 recombinant protein

Product name PX-P6553-100
Uniprot ID P08571
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Molecular weight 35.09 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Ala83
Aliases /Synonyms CD14, Monocyte differentiation antigen CD14Myeloid cell-specific leucine-rich glycoprotein,
Reference PX-P6553
Molecular Constructor
Fc Thr20–Ala83
Product name PX-P6553-1MG
Uniprot ID P08571
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Molecular weight 35.09 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Ala83
Aliases /Synonyms CD14, Monocyte differentiation antigen CD14Myeloid cell-specific leucine-rich glycoprotein,
Reference PX-P6553
Molecular Constructor
Fc Thr20–Ala83
Product name PX-P6553-50
Uniprot ID P08571
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Molecular weight 35.09 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Ala83
Aliases /Synonyms CD14, Monocyte differentiation antigen CD14Myeloid cell-specific leucine-rich glycoprotein,
Reference PX-P6553
Molecular Constructor
Fc Thr20–Ala83

There are no reviews yet.

Be the first to review “Human CD14 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products