Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

Note:
For research use only. Not suitable for human use.

Original price was: €346.00.Current price is: €266.00.

50ug 23% OFF + 266 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

Product name ARO-A16257-100
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456
Reference ARO-A16257
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen ctxB/Cholera Toxin Subunit B
Clone Name SAA1345
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody
Product name ARO-A16257-1MG
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456
Reference ARO-A16257
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen ctxB/Cholera Toxin Subunit B
Clone Name SAA1345
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody
Product name ARO-A16257-50
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456
Reference ARO-A16257
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen ctxB/Cholera Toxin Subunit B
Clone Name SAA1345
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody

SDS-PAGE for Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

SDS-PAGE for Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)

There are no reviews yet.

Be the first to review “Anti-Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B VHH (SAA1345)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products