Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Uniprot ID:
P01556
Molecular weight:
23.99 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Thr22–Asn124
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B Protein, N-His-SUMO

Product name ARO-P11536-100
Uniprot ID P01556
Origin species Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Expression system Prokaryotic expression
Raw Antigen Sequence TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Molecular weight 23.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr22-Asn124
Aliases /Synonyms Cholera enterotoxin subunit B, Cholera enterotoxin B chain, Cholera enterotoxin gamma chain, Choleragenoid, ctxB, toxB, VC_1456
Reference ARO-P11536
Note For research use only.
Molecular Constructor
Thr22–Asn124
Product name ARO-P11536-1MG
Uniprot ID P01556
Origin species Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Expression system Prokaryotic expression
Raw Antigen Sequence TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Molecular weight 23.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr22-Asn124
Aliases /Synonyms Cholera enterotoxin subunit B, Cholera enterotoxin B chain, Cholera enterotoxin gamma chain, Choleragenoid, ctxB, toxB, VC_1456
Reference ARO-P11536
Note For research use only.
Molecular Constructor
Thr22–Asn124
Product name ARO-P11536-50
Uniprot ID P01556
Origin species Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Expression system Prokaryotic expression
Raw Antigen Sequence TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Molecular weight 23.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr22-Asn124
Aliases /Synonyms Cholera enterotoxin subunit B, Cholera enterotoxin B chain, Cholera enterotoxin gamma chain, Choleragenoid, ctxB, toxB, VC_1456
Reference ARO-P11536
Note For research use only.
Molecular Constructor
Thr22–Asn124

Recombinant Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Vibrio cholerae serotype O1 ctxB/Cholera Toxin Subunit B Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products