Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Vibrio cholerae ctxB/Cholera Toxin Subunit B VHH (A9)

Note:
For research use only. Not suitable for human use.

380.00

100ug + 380 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Vibrio cholerae ctxB/Cholera Toxin Subunit B VHH (A9)

Product name Anti-Vibrio cholerae ctxB/Cholera Toxin Subunit B VHH (A9)
Uniprot ID P01556
Raw Antigen Sequence MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Cholera enterotoxin subunit B, anti-Cholera enterotoxin B chain, anti-Cholera enterotoxin gamma chain, anti-Choleragenoid, anti-ctxB, anti-toxB, anti-VC_1456, anti-Bacteria
Reference ARO-A16522
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen Vibrio cholerae ctxB/Cholera Toxin Subunit B
Clone Name A9
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody

Anti-Vibrio cholerae ctxB/Cholera Toxin Subunit B VHH (A9)

There are no reviews yet.

Be the first to review “Anti-Vibrio cholerae ctxB/Cholera Toxin Subunit B VHH (A9)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products