Name: Anoctamin-6(Ano6)
SKU: PX-P4625-10
Availability: InStock

Product name	Anoctamin-6(Ano6)
Uniprot ID	Q6P9J9
Uniprot link	https://www.uniprot.org/uniprot/Q6P9J9
Expression system	Eukaryotic expression
Sequence	MGWSCIILFLVATATGVHSAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNGSHHHHHH
Purity estimated	>10%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Ala745-Asn825
Aliases /Synonyms	Small-conductance calcium-activated nonselective cation channel,SCAN channel,Transmembrane protein 16F,Tmem16f
Reference	PX-P4625
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Anoctamin-6(Ano6)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.