Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Anoctamin-6(Ano6)

Host species:
Mammalian cells
Uniprot ID:
Q6P9J9

€420.00

100ug + 420 loyalty points
Ala745–Asn825
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anoctamin-6(Ano6)

Anoctamin-6(Ano6)

Product name Anoctamin-6(Ano6)
Uniprot ID Q6P9J9
Uniprot link https://www.uniprot.org/uniprot/Q6P9J9
Expression system Eukaryotic expression
Sequence MGWSCIILFLVATATGVHSAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNGSHHHHHH
Purity estimated >10%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala745-Asn825
Aliases /Synonyms Small-conductance calcium-activated nonselective cation channel,SCAN channel,Transmembrane protein 16F,Tmem16f
Reference PX-P4625
Note For research use only
Molecular Constructor
Ala745–Asn825
Product name Anoctamin-6(Ano6)
Uniprot ID Q6P9J9
Uniprot link https://www.uniprot.org/uniprot/Q6P9J9
Expression system Eukaryotic expression
Sequence MGWSCIILFLVATATGVHSAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNGSHHHHHH
Purity estimated >10%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala745-Asn825
Aliases /Synonyms Small-conductance calcium-activated nonselective cation channel,SCAN channel,Transmembrane protein 16F,Tmem16f
Reference PX-P4625
Note For research use only
Molecular Constructor
Ala745–Asn825

There are no reviews yet.

Be the first to review “Anoctamin-6(Ano6)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products