Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade

  • PX-TA1224-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

Product name Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 156586-92-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Altumomab,ZCE025,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1224
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 156586-92-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Altumomab,ZCE025,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1224
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1224-50
Uniprot ID P06731
Source CAS 156586-92-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Altumomab,ZCE025,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1224
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb: A Promising Antibody for Targeting CEACAM5 in

Cancer Therapy Introduction

Altumomab Biosimilar, also known as Anti-CEACAM5, CD66e mAb, is a monoclonal antibody that has been developed as a biosimilar to the original Altumomab antibody. This biosimilar has been designed to target the carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), also known as CD66e, which is a glycoprotein that is overexpressed in various types of cancer. In this article, we will discuss the structure, activity, and potential applications of Altumomab Biosimilar in cancer research.

Structure of Altumomab Biosimilar

Altumomab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been engineered to have a high binding affinity for CEACAM5. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL and CL1) and one variable domain (VL). The variable domains of Altumomab Biosimilar have been derived from the original Altumomab antibody, while the constant domains have been modified to minimize immunogenicity and enhance stability.

Mechanism of Action

Altumomab Biosimilar works by binding to CEACAM5, which is a cell surface glycoprotein that is overexpressed in various types of cancer, including colorectal, lung, and breast cancer. CEACAM5 is involved in cell adhesion, proliferation, and migration, and its overexpression has been linked to tumor growth and metastasis. By binding to CEACAM5, Altumomab Biosimilar blocks its function and triggers an immune response against cancer cells, leading to their destruction.

Potential Applications

Altumomab Biosimilar has shown promising results in preclinical studies as a potential therapeutic agent for various types of cancer. It has been shown to inhibit tumor growth and metastasis in animal models of colorectal, lung, and breast cancer. In addition, Altumomab Biosimilar has also been investigated as a potential imaging agent for the detection and monitoring of CEACAM5-positive tumors.

Clinical Trials

Altumomab Biosimilar is currently in the preclinical stage of development, and no clinical trials have been conducted yet. However, it has been granted orphan drug designation by the US Food and Drug Administration (FDA) for the treatment of colorectal cancer, which could expedite its development and approval process.

Conclusion

Altumomab Biosimilar, also known as Anti-CEACAM5, CD66e mAb, is a promising antibody that has been designed to target CEACAM5, a glycoprotein that is overexpressed in various types of cancer. With its high binding affinity and potential to trigger an immune response against cancer cells, Altumomab Biosimilar could be a valuable addition to the arsenal of cancer therapeutics. Further preclinical and clinical studies are needed to fully evaluate its safety and efficacy and bring this biosimilar to the market for the benefit of cancer patients.

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in WB Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade in WB Assay

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

SDS-PAGE for Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

Altumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Altumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

There are no reviews yet.

Be the first to review “Altumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products