Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

A. thaliana AteIF4E2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
A. thaliana
Uniprot ID:
Q9C7P2
Molecular weight:
29,79 kDa

Original price was: €263.00.Current price is: €210.00.

50ug 20% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

A. thaliana AteIF4E2 Recombinant Protein

Product name A. thaliana AteIF4E2 Recombinant Protein
Uniprot ID Q9C7P2
Uniprot link http://www.uniprot.org/uniprot/Q9C7P2
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMLEMVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKS TTVIQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPI CANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYND TIGFIVHEDAKTLDRDAKRRYTV
Molecular weight 29,79 kDa
Protein delivered with Tag? Yes
Purity estimated 75%
Buffer PBS, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_174252.1
Spec:Entrez GeneID 839836
Spec:NCBI Gene Aliases F15D2_16, F15D2.16, eukaryotic translation Initiation Factor 4E3
Spec:SwissProtID Q9C7P2
NCBI Reference NP_174252.1
Aliases /Synonyms AteIF4E2, Translation initiation factor eIF-4E
Reference PX-P1073
Note For research use only
Molecular Constructor
Full-length Yes
Product name A. thaliana AteIF4E2 Recombinant Protein
Uniprot ID Q9C7P2
Uniprot link http://www.uniprot.org/uniprot/Q9C7P2
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMLEMVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKS TTVIQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPI CANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYND TIGFIVHEDAKTLDRDAKRRYTV
Molecular weight 29,79 kDa
Protein delivered with Tag? Yes
Purity estimated 75%
Buffer PBS, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_174252.1
Spec:Entrez GeneID 839836
Spec:NCBI Gene Aliases F15D2_16, F15D2.16, eukaryotic translation Initiation Factor 4E3
Spec:SwissProtID Q9C7P2
NCBI Reference NP_174252.1
Aliases /Synonyms AteIF4E2, Translation initiation factor eIF-4E
Reference PX-P1073
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1073-1MG
Uniprot ID Q9C7P2
Uniprot link http://www.uniprot.org/uniprot/Q9C7P2
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMLEMVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKS TTVIQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPI CANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYND TIGFIVHEDAKTLDRDAKRRYTV
Molecular weight 29,79 kDa
Protein delivered with Tag? Yes
Purity estimated 75%
Buffer PBS, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_174252.1
Spec:Entrez GeneID 839836
Spec:NCBI Gene Aliases F15D2_16, F15D2.16, eukaryotic translation Initiation Factor 4E3
Spec:SwissProtID Q9C7P2
NCBI Reference NP_174252.1
Aliases /Synonyms AteIF4E2, Translation initiation factor eIF-4E
Reference PX-P1073
Note For research use only
Molecular Constructor
Full-length Yes

A. thaliana AteIF4E2 Recombinant Protein

There are no reviews yet.

Be the first to review “A. thaliana AteIF4E2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products