Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human NPC1L1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9UHC9
Molecular weight:
20,81 kDa

Original price was: €1,154.00.Current price is: €931.00.

100ug 19% OFF + 931 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human NPC1L1 Recombinant Protein

Product name Human NPC1L1 Recombinant Protein
Uniprot ID Q9UHC9
Uniprot link http://www.uniprot.org/uniprot/Q9UHC9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLRLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTSQVDW KDHFLYCANAPLTFKDGTALALSCMADYGAPVFPFLAIGGYKGKDYSEAEALIMTFSLNNYPAGDPRLAQAKLWEEAFLE EMRAFQRRMAGMFQVTFMAERS
Molecular weight 20,81 kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, imidazole 300mM in native conditions.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF20397.1
Spec:Entrez GeneID 29881
Spec:NCBI Gene Aliases NPC11L1
Spec:SwissProtID Q9UHC9
NCBI Reference AAF20397.1
Aliases /Synonyms NPC1L1 [450-620], NPC1L1 protein, truncated Niemann-Pick C1-like protein 1
Reference PX-P1131
Note For research use only
Molecular Constructor
Partial Yes
Product name Human NPC1L1 Recombinant Protein
Uniprot ID Q9UHC9
Uniprot link http://www.uniprot.org/uniprot/Q9UHC9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLRLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTSQVDW KDHFLYCANAPLTFKDGTALALSCMADYGAPVFPFLAIGGYKGKDYSEAEALIMTFSLNNYPAGDPRLAQAKLWEEAFLE EMRAFQRRMAGMFQVTFMAERS
Molecular weight 20,81 kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, imidazole 300mM in native conditions.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF20397.1
Spec:Entrez GeneID 29881
Spec:NCBI Gene Aliases NPC11L1
Spec:SwissProtID Q9UHC9
NCBI Reference AAF20397.1
Aliases /Synonyms NPC1L1 [450-620], NPC1L1 protein, truncated Niemann-Pick C1-like protein 1
Reference PX-P1131
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1131-1MG
Uniprot ID Q9UHC9
Uniprot link http://www.uniprot.org/uniprot/Q9UHC9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLRLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTSQVDW KDHFLYCANAPLTFKDGTALALSCMADYGAPVFPFLAIGGYKGKDYSEAEALIMTFSLNNYPAGDPRLAQAKLWEEAFLE EMRAFQRRMAGMFQVTFMAERS
Molecular weight 20,81 kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, imidazole 300mM in native conditions.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF20397.1
Spec:Entrez GeneID 29881
Spec:NCBI Gene Aliases NPC11L1
Spec:SwissProtID Q9UHC9
NCBI Reference AAF20397.1
Aliases /Synonyms NPC1L1 [450-620], NPC1L1 protein, truncated Niemann-Pick C1-like protein 1
Reference PX-P1131
Note For research use only
Molecular Constructor
Partial Yes

Human NPC1L1 Recombinant Protein

There are no reviews yet.

Be the first to review “Human NPC1L1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products