A. thaliana AteIF4E2 Recombinant Protein

Reference:
Brand

Product type

Host Species

Size

,

Description of A. thaliana AteIF4E2 Recombinant Protein

Product nameA. thaliana AteIF4E2 Recombinant Protein
Uniprot IDQ9C7P2
Uniprot linkhttp://www.uniprot.org/uniprot/Q9C7P2
Origin speciesA. thaliana
Expression systemProcaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMLEMVVMDSPVSGRMADQNIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKKNYASKKS TTVIQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPI CANGGKWTMFFPRATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYND TIGFIVHEDAKTLDRDAKRRYTV
Molecular weight29,79 kDa
Protein delivered with Tag?Yes
Purity estimated75%
BufferPBS, Urea 8M, pH4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_174252.1
Spec:Entrez GeneID839836
Spec:NCBI Gene AliasesF15D2_16, F15D2.16, eukaryotic translation Initiation Factor 4E3
Spec:SwissProtIDQ9C7P2
NCBI ReferenceNP_174252.1
Aliases /SynonymsAteIF4E2, Translation initiation factor eIF-4E
ReferencePX-P1073
NoteFor research use only

Reviews

There are no reviews yet.

Be the first to review “A. thaliana AteIF4E2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Clear
OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us

Category: