A. thaliana AteIF4E1 Recombinant Protein

Reference:

Description of A. thaliana AteIF4E1 Recombinant Protein

Product name	A. thaliana AteIF4E1 Recombinant Protein
Uniprot ID	O23252
Uniprot link	http://www.uniprot.org/uniprot/O23252
Origin species	A. thaliana
Expression system	Procaryotic expression
Sequence	MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA
Molecular weight	28,76 kDa
Protein delivered with Tag?	Yes
Purity estimated	>90%
Buffer	PBS, imidazole 300mM, pH7,4
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Protein Accession	NP_193538.1
Spec:Entrez GeneID	827529
Spec:NCBI Gene Aliases	AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1
Spec:SwissProtID	O23252
NCBI Reference	NP_193538.1
Aliases /Synonyms	AteIF4E1, translation initiation factor eIF-4E
Reference	PX-P1072
Note	For research use only