A. thaliana AteIF4E1 Recombinant Protein

Reference:
Brand

Product type

Host Species

Size

,

Description of A. thaliana AteIF4E1 Recombinant Protein

Product nameA. thaliana AteIF4E1 Recombinant Protein
Uniprot IDO23252
Uniprot linkhttp://www.uniprot.org/uniprot/O23252
Origin speciesA. thaliana
Expression systemProcaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA
Molecular weight28,76 kDa
Protein delivered with Tag?Yes
Purity estimated>90%
BufferPBS, imidazole 300mM, pH7,4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_193538.1
Spec:Entrez GeneID827529
Spec:NCBI Gene AliasesAT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1
Spec:SwissProtIDO23252
NCBI ReferenceNP_193538.1
Aliases /SynonymsAteIF4E1, translation initiation factor eIF-4E
ReferencePX-P1072
NoteFor research use only

Reviews

There are no reviews yet.

Be the first to review “A. thaliana AteIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Clear
OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us

Category: