Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

A. thaliana AteIF4E1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
A. thaliana
Uniprot ID:
O23252
Molecular weight:
28,76 kDa

Original price was: €269.00.Current price is: €210.00.

50ug 22% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

A. thaliana AteIF4E1 Recombinant Protein

Product name A. thaliana AteIF4E1 Recombinant Protein
Uniprot ID O23252
Uniprot link http://www.uniprot.org/uniprot/O23252
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA
Molecular weight 28,76 kDa
Protein delivered with Tag? Yes
Purity estimated >90%
Buffer PBS, imidazole 300mM, pH7,4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_193538.1
Spec:Entrez GeneID 827529
Spec:NCBI Gene Aliases AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1
Spec:SwissProtID O23252
NCBI Reference NP_193538.1
Aliases /Synonyms AteIF4E1, translation initiation factor eIF-4E
Reference PX-P1072
Note For research use only
Molecular Constructor
Full-length Yes
Product name A. thaliana AteIF4E1 Recombinant Protein
Uniprot ID O23252
Uniprot link http://www.uniprot.org/uniprot/O23252
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA
Molecular weight 28,76 kDa
Protein delivered with Tag? Yes
Purity estimated >90%
Buffer PBS, imidazole 300mM, pH7,4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_193538.1
Spec:Entrez GeneID 827529
Spec:NCBI Gene Aliases AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1
Spec:SwissProtID O23252
NCBI Reference NP_193538.1
Aliases /Synonyms AteIF4E1, translation initiation factor eIF-4E
Reference PX-P1072
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1072-1MG
Uniprot ID O23252
Uniprot link http://www.uniprot.org/uniprot/O23252
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA
Molecular weight 28,76 kDa
Protein delivered with Tag? Yes
Purity estimated >90%
Buffer PBS, imidazole 300mM, pH7,4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_193538.1
Spec:Entrez GeneID 827529
Spec:NCBI Gene Aliases AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1
Spec:SwissProtID O23252
NCBI Reference NP_193538.1
Aliases /Synonyms AteIF4E1, translation initiation factor eIF-4E
Reference PX-P1072
Note For research use only
Molecular Constructor
Full-length Yes

A. thaliana AteIF4E1 Recombinant Protein

There are no reviews yet.

Be the first to review “A. thaliana AteIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products