Transaldolase(TALDO1)

Reference:
Product nameTransaldolase(TALDO1)
Uniprot IDP37837
Uniprot linkhttps://www.uniprot.org/uniprot/P37837
Expression systemProcaryotic expression
SequenceMGMSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQED QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEE QHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASF RNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAAD AVKLERMLTERMFNAENGKGSHHHHHH
Molecular weight38.7kDa
Protein delivered with Tag?C-terminal His Tag
Purity estimated>90% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeMet1-Lys337
Protein AccessionP37837
Spec:Entrez GeneID6888
Spec:NCBI Gene AliasesTAL; TALH; TAL-H; TALDOR
Spec:SwissProtIDQ8WV32
NCBI ReferenceP37837
Aliases /SynonymsTAL, TALDO, TALDOR
ReferencePX-P4816
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Transaldolase(TALDO1)”

Your email address will not be published. Required fields are marked *

Related products

Natalizumab Biosimilar – Anti-ITGA4, CD49d mAb – Research Grade
Biosimilar Natalizumab Biosimilar – Anti-ITGA4, CD49d mAb – Research Grade PX-TA1053 300€
Rontalizumab Biosimilar – Anti-IFNA1 mAb – Research Grade
Biosimilar Rontalizumab Biosimilar – Anti-IFNA1 mAb – Research Grade PX-TA1235 400€
Elezanumab Biosimilar – Anti-RGMA mAb – Research Grade
Biosimilar Elezanumab Biosimilar – Anti-RGMA mAb – Research Grade PX-TA1439 400€
Talacotuzumab Biosimilar – Anti-NOTCH2,  NOTCH3 mAb – Research Grade
Biosimilar Talacotuzumab Biosimilar – Anti-NOTCH2, NOTCH3 mAb – Research Grade PX-TA1476 400€
Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
Biosimilar Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade PX-TA1483 300€
Talizumab Biosimilar – Anti-IgE mAb – Research Grade
Biosimilar Talizumab Biosimilar – Anti-IgE mAb – Research Grade PX-TA1631 400€
Talquetamab Biosimilar – Anti-CD3E, GPRC5D  mAb – Research Grade
Biosimilar Talquetamab Biosimilar – Anti-CD3E, GPRC5D mAb – Research Grade PX-TA1632 400€
Nipocalimab Biosimilar – Anti-FCGRT mAb – Research Grade
Biosimilar Nipocalimab Biosimilar – Anti-FCGRT mAb – Research Grade PX-TA1690 400€
Transaldolase(TALDO1)
Receptor Transaldolase(TALDO1) PX-P4816 110€
CD257 Recombinant Protein
Ligand CD257 Recombinant Protein PX-P4112 406€
Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.