Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)

Reference:
Product nameRibonucleoside-diphosphate reductase subunit M2 B(RRM2B)
Uniprot IDQ7LG56
Uniprot linkhttps://www.uniprot.org/uniprot/Q7LG56
Origin speciesHomo sapiens (Human)
Expression systemProcaryotic expression
SequenceMGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS KDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDT YIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPG LTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEF VADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
Molecular weight40.74 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeMet1-Phe351
Protein AccessionQ7LG56
Spec:Entrez GeneID50484
Spec:NCBI Gene AliasesP53R2; MTDPS8A; MTDPS8B
Spec:SwissProtIDQ17RZ6
NCBI ReferenceQ7LG56
Aliases /SynonymsTP53-inducible ribonucleotide reductase M2 B,p53-inducible ribonucleotide reductase small subunit 2-like protein,p53R2,P53R2
ReferencePX-P4793
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.