Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade

  • PX-TA2091-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

Product name Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade
Uniprot ID P18627
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3
Reference PX-TA2091
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade
Uniprot ID P18627
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3
Reference PX-TA2091
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2091-50
Uniprot ID P18627
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3
Reference PX-TA2091
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Tuparstobart Biosimilar – Anti-FDC mAb is a novel therapeutic antibody that has been developed to target follicular dendritic cells (FDCs). FDCs are specialized cells found in the lymphoid tissues that play a crucial role in the immune response by presenting antigens to B cells and promoting their activation and differentiation into plasma cells. This biosimilar antibody has been designed to mimic the structure and function of the naturally occurring anti-FDC antibodies, making it a promising candidate for the treatment of various immune disorders. In this article, we will discuss the structure, activity, and potential applications of Tuparstobart Biosimilar – Anti-FDC mAb in detail.

Structure of Tuparstobart Biosimilar – Anti-FDC mAb

Tuparstobart Biosimilar – Anti-FDC mAb is a monoclonal antibody that is produced by recombinant DNA technology. It is a fully humanized IgG1 antibody that contains two heavy chains and two light chains, each with a variable and a constant region. The variable regions of the antibody are responsible for binding to the FDCs, while the constant regions mediate effector functions such as complement activation and antibody-dependent cell-mediated cytotoxicity (ADCC). The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days, making it suitable for therapeutic use.

Activity of Tuparstobart Biosimilar – Anti-FDC mAb

Tuparstobart Biosimilar – Anti-FDC mAb has a high affinity for FDCs and binds to them with specificity and selectivity. This binding leads to the inhibition of FDC function, preventing their ability to present antigens to B cells. This, in turn, suppresses the activation and differentiation of B cells into plasma cells, thereby reducing the production of antibodies. Additionally, the antibody also activates complement and induces ADCC, resulting in the destruction of FDCs. These activities of Tuparstobart Biosimilar – Anti-FDC mAb make it a potent immunosuppressive agent that can be used to treat various immune-mediated disorders.

Applications of Tuparstobart Biosimilar – Anti-FDC mAb

Tuparstobart Biosimilar – Anti-FDC mAb has shown promising results in preclinical studies and has the potential to be used in the treatment of a wide range of immune disorders. Some of the potential applications of this biosimilar antibody are discussed below:

1.

Autoimmune disorders: FDCs play a crucial role in the development of autoimmune disorders by promoting the production of autoantibodies. By inhibiting FDC function, Tuparstobart Biosimilar – Anti-FDC mAb can reduce the production of autoantibodies and alleviate the symptoms of autoimmune diseases such as rheumatoid arthritis, lupus, and multiple sclerosis.

2. Allergies: FDCs are also involved in the production of IgE antibodies, which play a role in allergic reactions. By targeting FDCs, Tuparstobart Biosimilar – Anti-FDC mAb can potentially reduce the production of IgE and alleviate the symptoms of allergies.

3. Organ transplant rejection: FDCs are known to play a role in the rejection of transplanted organs by promoting the production of donor-specific antibodies. By inhibiting FDC function, Tuparstobart Biosimilar – Anti-FDC mAb can reduce the risk of organ rejection and improve the success rate of organ transplantation.

4.

Cancer: FDCs have been found to play a role in the growth and survival of certain types of cancer cells. By targeting FDCs, Tuparstobart Biosimilar – Anti-FDC mAb can potentially inhibit the growth and spread of cancer cells, making it a promising candidate for cancer therapy.

Conclusion

Tuparstobart Biosimilar – Anti-FDC mAb is a novel therapeutic antibody that has been designed to target FDCs and inhibit their function. Its unique structure and potent activity make it a promising candidate for the treatment of various immune disorders, including autoimmune diseases, allergies, organ transplant rejection, and cancer.

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade in ELISA Assay

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade in ELISA Assay

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

SDS-PAGE for Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade , on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tuparstobart Biosimilar - Anti-FDC mAb - Research Grade

There are no reviews yet.

Be the first to review “Tuparstobart Biosimilar – Anti-FDC mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products