Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Tumor-associated calcium signal transducer 2(TACSTD2) |
|---|---|
| Uniprot ID | P09758 |
| Uniprot link | https://www.uniprot.org/uniprot/P09758 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Molecular weight | 35-45kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Thr274 |
| Protein Accession | P09758 |
| Spec:Entrez GeneID | 4070 |
| Spec:NCBI Gene Aliases | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
| Spec:SwissProtID | Q15658 |
| NCBI Reference | P09758 |
| Aliases /Synonyms | GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2;Membrane component chromosome 1 surface marker 1;Pancreatic carcinoma marker protein GA733-1 |
| Reference | PX-P4569 |
| Note | For research use only |
Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.