Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              
              | size | 100ug, 50ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Mammalian cells  | 
		
| Applications | Elisa, WB  | 
		
| Product name | Tumor-associated calcium signal transducer 2(TACSTD2) | 
|---|---|
| Uniprot ID | P09758 | 
| Uniprot link | https://www.uniprot.org/uniprot/P09758 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Eukaryotic expression | 
| Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT | 
| Molecular weight | 35-45kDa | 
| Protein delivered with Tag? | C-terminal His Tag | 
| Purity estimated | >95% by SDS-PAGE | 
| Buffer | PBS pH 7.5 | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days  | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Mammalian cells | 
| Fragment Type | Met1-Thr274 | 
| Protein Accession | P09758 | 
| Spec:Entrez GeneID | 4070 | 
| Spec:NCBI Gene Aliases | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 | 
| Spec:SwissProtID | Q15658 | 
| NCBI Reference | P09758 | 
| Aliases /Synonyms | GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2;Membrane component chromosome 1 surface marker 1;Pancreatic carcinoma marker protein GA733-1 | 
| Reference | PX-P4569 | 
| Note | For research use only | 
                Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.