Transferrin receptor protein 1(TFRC)

Reference:
Product nameTransferrin receptor protein 1(TFRC)
Uniprot IDP02786
Uniprot linkhttps://www.uniprot.org/uniprot/P02786
Origin speciesHomo sapiens (Human)
Expression systemProcaryotic expression
SequenceQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPE LNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATS RLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAF NETLFRNQLALATWTIQGAANALSG
Molecular weight27.59 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5, 0.02% SKL
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeGln511-Gly751
Protein AccessionP02786
Spec:Entrez GeneID7037
Spec:NCBI Gene AliasesT9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Spec:SwissProtIDQ9UK21
NCBI ReferenceP02786
Aliases /SynonymsTR,TfR,TfR1,Trfr,T9,p90,CD_antigen: CD71
ReferencePX-P4795
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Transferrin receptor protein 1(TFRC)”

Your email address will not be published. Required fields are marked *

Related products

Pabinafusp Biosimilar – Anti-TFRC mAb – Research Grade
Biosimilar Pabinafusp Biosimilar – Anti-TFRC mAb – Research Grade PX-TA1874 400€
Trontinemab Biosimilar – Anti-APP Abeta 1-40, 42;TFRC mAb – Research Grade
Biosimilar Trontinemab Biosimilar – Anti-APP Abeta 1-40, 42;TFRC mAb – Research Grade PX-TA1887 400€
Hu23B12 Biosimilar – Anti-TSLP mAb – Research Grade
Biosimilar Hu23B12 Biosimilar – Anti-TSLP mAb – Research Grade PX-TA1902 400€
MOR014824 Biosimilar – Anti-TSLP mAb – Research Grade
Biosimilar MOR014824 Biosimilar – Anti-TSLP mAb – Research Grade PX-TA1905 400€
VAK-694 Biosimilar – Anti-Binetrakin mAb – Research Grade
Biosimilar VAK-694 Biosimilar – Anti-Binetrakin mAb – Research Grade PX-TA1911 400€
SYN-005-1B7 Biosimilar – Anti-Pertussis toxin subunit 1 mAb – Research Grade
Biosimilar SYN-005-1B7 Biosimilar – Anti-Pertussis toxin subunit 1 mAb – Research Grade PX-TA1918 400€
Pogalizumab Biosimilar – Anti-ACT35 antigen mAb – Research Grade
Biosimilar Pogalizumab Biosimilar – Anti-ACT35 antigen mAb – Research Grade PX-TA1923 400€
Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade
Biosimilar Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade PX-TA1925 400€
Stable Isotope Labeled Sotrovimab  Biosimilar – Anti-Spike glycoprotein mAb – Research Grade
SIL Stable Isotope Labeled Sotrovimab Biosimilar – Anti-Spike glycoprotein mAb – Research Grade PX-TA1637-SIL 1500€
Human GITRL recombinant protein
Ligand Human GITRL recombinant protein PX-P6016 385€
Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.