Tomato Le_eIF4E1 Recombinant Protein

Reference:
Product nameTomato Le_eIF4E1 Recombinant Protein
Uniprot IDQ4VQY3
Uniprot linkhttp://www.uniprot.org/uniprot/Q4VQY3
Origin speciesTomato
Expression systemProcaryotic expression
SequenceMSGHHHHHHAMAAAEMERTMSFDAAEKLKAADGGGGEVDDELEEGEIVEESNDTASYLGKEITVKHPLEHSWTFWFDNPT TKSRQTAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLIMGADFHCFKHKIEPKWEDPVCANGGTWKMSFSKGKSDTSWLY TLLAMIGHQFDHGDEICGAVVSVRAKGEKIALWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLDRNAKNRYT V
Molecular weight27,16 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferPBS, Urea 8M, imidazole 10mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionAAV88610.1
Spec:SwissProtIDQ4VQY3
NCBI ReferenceAAV88610.1
Aliases /SynonymsLe_eIF4E1, eukaryotic translation initiation factor 4E
ReferencePX-P1119
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tomato Le_eIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.