Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Tomato Le_eIF4E1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Tomato
Uniprot ID:
Q4VQY3
Molecular weight:
27,16 kDa

€210.00

50ug + 210 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tomato Le_eIF4E1 Recombinant Protein

Tomato Le_eIF4E1 Recombinant Protein

Product name Tomato Le_eIF4E1 Recombinant Protein
Uniprot ID Q4VQY3
Uniprot link http://www.uniprot.org/uniprot/Q4VQY3
Origin species Tomato
Expression system Prokaryotic expression
Sequence MSGHHHHHHAMAAAEMERTMSFDAAEKLKAADGGGGEVDDELEEGEIVEESNDTASYLGKEITVKHPLEHSWTFWFDNPT TKSRQTAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLIMGADFHCFKHKIEPKWEDPVCANGGTWKMSFSKGKSDTSWLY TLLAMIGHQFDHGDEICGAVVSVRAKGEKIALWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLDRNAKNRYT V
Molecular weight 27,16 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, Urea 8M, imidazole 10mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAV88610.1
Spec:SwissProtID Q4VQY3
NCBI Reference AAV88610.1
Aliases /Synonyms Le_eIF4E1, eukaryotic translation initiation factor 4E
Reference PX-P1119
Note For research use only
Molecular Constructor
Full-length Yes
Product name Tomato Le_eIF4E1 Recombinant Protein
Uniprot ID Q4VQY3
Uniprot link http://www.uniprot.org/uniprot/Q4VQY3
Origin species Tomato
Expression system Prokaryotic expression
Sequence MSGHHHHHHAMAAAEMERTMSFDAAEKLKAADGGGGEVDDELEEGEIVEESNDTASYLGKEITVKHPLEHSWTFWFDNPT TKSRQTAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLIMGADFHCFKHKIEPKWEDPVCANGGTWKMSFSKGKSDTSWLY TLLAMIGHQFDHGDEICGAVVSVRAKGEKIALWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLDRNAKNRYT V
Molecular weight 27,16 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, Urea 8M, imidazole 10mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAV88610.1
Spec:SwissProtID Q4VQY3
NCBI Reference AAV88610.1
Aliases /Synonyms Le_eIF4E1, eukaryotic translation initiation factor 4E
Reference PX-P1119
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Tomato Le_eIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products