Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tidutamab Biosimilar – Anti-CD3 epsilon, SSTR2 mAb – Research Grade

  • PX-TA1565-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-kappa / scFv-h-CH2-CH3

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tidutamab Biosimilar - Anti-CD3 epsilon, SSTR2 mAb - Research Grade

Product name Tidutamab Biosimilar - Anti-CD3 epsilon, SSTR2 mAb - Research Grade
Uniprot ID P30874 & P07766
Source CAS 2148354-90-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tidutamab ,XmAb-18087,CD3 epsilon, SSTR2,anti-CD3 epsilon, SSTR2
Reference PX-TA1565
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name Tidutamab Biosimilar - Anti-CD3 epsilon, SSTR2 mAb - Research Grade
Uniprot ID P30874 & P07766
Source CAS 2148354-90-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tidutamab ,XmAb-18087,CD3 epsilon, SSTR2,anti-CD3 epsilon, SSTR2
Reference PX-TA1565
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1565-50
Uniprot ID P30874 & P07766
Source CAS 2148354-90-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tidutamab ,XmAb-18087,CD3 epsilon, SSTR2,anti-CD3 epsilon, SSTR2
Reference PX-TA1565
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody

Tidutamab Biosimilar – Anti-CD3 epsilon, SSTR2 mAb – Research Grade Introduction

Tidutamab Biosimilar is a novel monoclonal antibody (mAb) that targets two important therapeutic targets, CD3 epsilon and SSTR2. This research grade mAb is designed to have a similar structure and activity as the original Tidutamab, but at a more affordable cost. In this article, we will provide a detailed scientific description of Tidutamab Biosimilar, including its structure, activity, and potential applications.

Structure of Tidutamab Biosimilar

Tidutamab Biosimilar is a recombinant, humanized IgG1 monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of Tidutamab Biosimilar is specific for CD3 epsilon and the constant region is derived from human IgG1. The molecular weight of Tidutamab Biosimilar is approximately 150 kDa.

The three-dimensional structure of Tidutamab Biosimilar is similar to that of the original Tidutamab. It consists of a Y-shaped molecule with two heavy chains and two light chains connected by disulfide bonds. The variable regions of the heavy and light chains form the antigen-binding site, while the constant regions determine the effector functions of the antibody.

Activity of Tidutamab Biosimilar

Tidutamab Biosimilar is a dual-targeting antibody that binds to both CD3 epsilon and SSTR2. CD3 epsilon is a subunit of the T-cell receptor complex and is essential for T-cell activation. By binding to CD3 epsilon, Tidutamab Biosimilar can activate T-cells and enhance their anti-tumor activity. SSTR2, on the other hand, is a receptor for somatostatin, a hormone that inhibits the growth of various tumors. By targeting SSTR2, Tidutamab Biosimilar can directly inhibit the growth of tumor cells.

In addition to its dual-targeting activity, Tidutamab Biosimilar also has a strong binding affinity for both CD3 epsilon and SSTR2. This allows for efficient and specific targeting of these therapeutic targets, leading to enhanced therapeutic effects.

Potential Applications of Tidutamab Biosimilar

Tidutamab Biosimilar has potential applications in the treatment of various types of cancer, including solid tumors and hematologic malignancies. By targeting both CD3 epsilon and SSTR2, Tidutamab Biosimilar can activate T-cells and directly inhibit tumor growth, making it a promising therapy for cancer treatment.

In addition, Tidutamab Biosimilar may also have potential applications in autoimmune diseases. By targeting CD3 epsilon, Tidutamab Biosimilar can modulate the activity of T-cells and potentially suppress the immune response, making it a potential therapy for autoimmune disorders such as rheumatoid arthritis and multiple sclerosis.

Conclusion

Tidutamab Biosimilar is a novel monoclonal antibody that targets both CD3 epsilon and SSTR2. Its structure, activity, and potential applications make it a promising therapy for cancer and autoimmune diseases. As a research grade antibody, Tidutamab Biosimilar provides a more affordable option for researchers and clinicians to study and potentially utilize in their treatments. Further studies and clinical trials are needed to fully explore the potential of Tidutamab Biosimilar in the field of medicine.

Keywords: Tidutamab Biosimilar, monoclonal antibody, CD3 epsilon, SSTR2, therapeutic target, structure, activity, application, cancer, autoimmune diseases, research grade.

Flow Cytometry results for Tidutamab Biosimilar - Anti-SSTR2 and CD3E mAb - Research Grade

Flow Cytometry results for Tidutamab Biosimilar - Anti-SSTR2 and CD3E mAb - Research Grade

Flow-cytometry FITC using anti-human SSTR2 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an FITC anti-human SSTR2 monoclonal antibody (Catalog PX-TA1565) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Tidutamab Biosimilar - Anti-SSTR2 and CD3E mAb - Research Grade

Flow Cytometry results for Tidutamab Biosimilar - Anti-SSTR2 and CD3E mAb - Research Grade

Flow-cytometry APC using anti-human SSTR2 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an APC anti-human SSTR2 monoclonal antibody (Catalog PX-TA1565) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Tidutamab  Biosimilar - Anti-CD3 epsilon, SSTR2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tidutamab Biosimilar – Anti-CD3 epsilon, SSTR2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products