Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

TGFB1 recombinant protein

  • PX-P5187-100
  • Validated ELISA
Host species:
Yeast
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01137
Molecular weight:
10.59 kDa

Original price was: €542.00.Current price is: €420.00.

100ug 23% OFF + 420 loyalty points
His Gly316–Ser390
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

TGFB1 recombinant protein

Product name PX-P5187-100
Uniprot ID P01137
Uniprot link https://www.uniprot.org/uniprot/P01137
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular weight 10.59 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Gly316-Ser390
Protein Accession P01137
Aliases /Synonyms TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB
Reference PX-P5187
Note For research use only.
Molecular Constructor
His Gly316–Ser390
Product name PX-P5187-1MG
Uniprot ID P01137
Uniprot link https://www.uniprot.org/uniprot/P01137
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular weight 10.59 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Gly316-Ser390
Protein Accession P01137
Aliases /Synonyms TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB
Reference PX-P5187
Note For research use only.
Molecular Constructor
His Gly316–Ser390
Product name PX-P5187-50
Uniprot ID P01137
Uniprot link https://www.uniprot.org/uniprot/P01137
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular weight 10.59 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Gly316-Ser390
Protein Accession P01137
Aliases /Synonyms TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB
Reference PX-P5187
Note For research use only.
Molecular Constructor
His Gly316–Ser390

TGFB1 recombinant protein binds to Fresolimumab Biosimilar - Anti-TGFB, TGF beta mAb in indirect ELISA assay

TGFB1 recombinant protein binds to Fresolimumab Biosimilar - Anti-TGFB, TGF beta mAb in indirect ELISA assay

Immobilized TGFB1 recombinant protein (cat. No.PX-P5187) at 0.5µg/mL (100µL/well) can bind Fresolimumab Biosimilar - Anti-TGFB, TGF beta mAb (cat. No.PX-TA1128) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 217.5M.

TGFB1 recombinant protein binds to Metelimumab Biosimilar - Anti-TGFB1 mAb in indirect ELISA assay

TGFB1 recombinant protein binds to Metelimumab Biosimilar - Anti-TGFB1 mAb in indirect ELISA assay

Immobilized TGFB1 recombinant protein (cat. No.PX-P5187) at 0.5µg/mL (100µL/well) can bind Metelimumab Biosimilar - Anti-TGFB1 mAb (cat. No.PX-TA1138) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 133.8M.

TGFB1 recombinant protein

There are no reviews yet.

Be the first to review “TGFB1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products